SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000015152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000015152
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.35e-48
Family Calponin-homology domain, CH-domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 204-266
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.53e-22
Family EB1 dimerisation domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000015152
Sequence length 284
Comment (Gasterosteus aculeatus)
Sequence
VRSSTAYMFGMAVNVYATSVSIDNLSRHDMLAWVNDSLHLTYTKIEQLCSGAAYCQFMDM
LFPGCILLKKVKFQAKLEHESIHNFKVLQAAFKRMSVDKIIPVEKLVKGKFQDNFEFVQW
FKKFFDANYDGKEYDPLLSRQGQDVAPAPNPGDHFIHKPKRTPGPQRTSPTVPKNMPTPQ
RVQHNTPAMRKNPSLSRNGGSDAEIMELNQQLMELKLTVDGLEKERDFYFSKLRDIELIC
QEHESENNSVLSSIINILYATEDGFAPPEDEDLDEQAHLDQDEY
Download sequence
Identical sequences G3PC28
ENSGACP00000015152 ENSGACP00000015152 69293.ENSGACP00000015152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]