SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000015279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000015279
Domain Number 1 Region: 14-142,170-276
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.59e-77
Family Calponin-homology domain, CH-domain 0.0000305
Further Details:      
 
Domain Number 2 Region: 6959-7107
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-20
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 7820-7944
Classification Level Classification E-value
Superfamily Spectrin repeat 5.47e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 8040-8195
Classification Level Classification E-value
Superfamily Spectrin repeat 5.64e-19
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 7412-7543
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 3332-3452
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-16
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 7 Region: 4505-4662
Classification Level Classification E-value
Superfamily Spectrin repeat 4.25e-16
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 2676-2800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000117
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 9 Region: 7077-7217
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000124
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 8377-8535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000183
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 11 Region: 5046-5205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000062
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 12 Region: 2401-2518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000708
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 13 Region: 6748-6888
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000628
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 14 Region: 5714-5812
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000222
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 15 Region: 2248-2402
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 3768-3883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 17 Region: 7496-7651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000619
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 18 Region: 1439-1556
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000732
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 19 Region: 8499-8639
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000992
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 20 Region: 7285-7405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000025
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 21 Region: 4286-4443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000304
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 22 Region: 7949-8058
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000345
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 23 Region: 3564-3697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000353
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 24 Region: 3063-3174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000504
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 25 Region: 3915-4033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000537
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 26 Region: 2035-2151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000454
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 27 Region: 561-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000461
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 28 Region: 4617-4770
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000824
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 29 Region: 7730-7833
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000109
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 1074-1221
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 31 Region: 2834-2946
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000366
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 32 Region: 1619-1744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000111
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 33 Region: 6543-6626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000099
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 34 Region: 1947-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000048
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 35 Region: 7653-7767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000119
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 36 Region: 3173-3281
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000121
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 5174-5280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000192
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 5925-6059
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000683
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number 39 Region: 1714-1864
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000101
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 40 Region: 4957-5067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000138
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 41 Region: 3999-4132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000201
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 42 Region: 6672-6785
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000272
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 43 Region: 3485-3595
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000465
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 44 Region: 873-1012
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000576
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 45 Region: 5479-5630
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000921
Family Spectrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000015279
Domain Number - Region: 5297-5404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000222
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number - Region: 2514-2613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 4834-4983
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000758
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 6363-6463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00106
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6071-6188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number - Region: 1233-1344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00301
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1307-1405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00324
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 704-800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00537
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 6873-6959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00906
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number - Region: 2158-2263
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0127
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 5605-5692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 2595-2665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0647
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 382-498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0916
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000015279
Sequence length 8784
Comment (Gasterosteus aculeatus)
Sequence
MASPRNFGRSSVDIANVMQKLQDEQEAVQKRTFTKWINSHLAKYKPPLEVNDLFEDIKDG
VKLLALLEVLSGQRLPREQGRQLKRIHWVSNIGTALKFLEGRKIKLVNIHATDIADGRPS
IVLGLIWTVILYFQIEELTSNLQALSNSNSSLESLASSEAGSPPMKRKGVTKFQGNAKKA
LLKWVQCTAAKYHGIEVKDFGPSWRNGVAFQSVVHAIRPDLVDMEVVRRRSNRENLEEAF
ALAENELGIPRLLDAEDVDVDKPDEKSIMTYVAQFLKHYPNPHHSETDGQQDEIKLLLGS
IPTFALSVPVLQREERKMLRELKVFLDQLERDVLQAQGAEGNLTDKYQAFKSFRVQYEMK
KKQTDPLLQPVHRDGKLSVDQALVKQAWDRVSARLLDWHIHLDKSLPGPLGVIGAWLHRA
EMALREDIPIQHAHEETANVLHRKLEQHKEVLKNLESHKQTFQQIHRDRSVNGVPVPPEQ
LQDMAERFNFVSTSSHAHLIKLEFWEMKYRLMAFLMLAESKLKSWIIKYGRRDSVELLLQ
TYLTFVEGHQFFEQYEVIFTGLKQAAEVYVKSDSSIDEAEGVSKFLGEATCQWRNLALEV
RSVRSMLEEVITNWEKYSSTVASLQAWLEDGEQMLNQSENSKRDFFRNLSHWMQQHMDMN
DAGNFLIETCDDTVSRDLKQQLLLLNGRWRELFVKVKHYARADEVDKLRQDYQDGINTLK
MFMDATDEKMNAPVQVSFLNVRAFVQDVEEVKHKVPAMEAACKAASRTAQLLAKDTPQEE
VSQMMAVMASIKEQLSKVRERCLPLLRDSQSLLPPLEEMEKNITGFYQALEKASHITSTG
DPEGPVDFKQNCQELVTFTHSCKKCLTAIERNHQTIQKIMNSSNTLQYMDMSLLQKRVAD
LQSSSQGMIKESSEWRKHVEANSCLMKRFDESRIELEKVLKMAQNCLTERGNPEELLKKH
TEFFDQLDQRVLNTFLKACDELTDILPEQEQQSLQETVRKLHKHWKDIQSDAPFHLLHLK
VEVERSKMMVLLQECQAEVTRENRHLASMGSERLVKEHRAFFREKGPLSICEKRLQLMEE
LCQKLPEADPVHQTMQTSRKDFSEVREEIENTHQKLMQHPDKWNEYNSRYAELSCWLISK
ESQLRLLRTRANDPRKYGQVKATITELRNDAELQEGNLGWLKARIAVLVEICADSDAQMQ
GSTLSKLSTDFKGLLASLVEAEKMVLAVGDCVQFREEVQTILDDLLQGQKEAQAEVTKIL
DCATVREAQQLLLVHQQLLKRLKMKRKDVQQLITRGQQLQAEEGLGETLQSDLQTLENTL
GKMEQTMDSQEQSLEVTLAAWQEFDSQQAAVHEFVNKARSTMDRDLNFSSPESLAVELDQ
AGVLLKQCEAEASHMNTLLKRAKEIQLGPKNKTLLLQQASSLSGQVDKVEASLKKDVETL
EEMKAQWDQFGTGLENLSLWISDKEKQLDVLKSSPLPLEHQINTVKAVGAELQERASVPC
QLEADSQALAQFVSSGEAARIKARLTQIGRYWEELKESIQQLDGQLEESSSHQQKFQISH
EEVQASLTELHAKLEHPIKSCTSSSETYKALQDHMDVCQNQEKLKGALLTLSAGARRLSD
KEQAERIMTALNHTYDQSVQEAKDKQSTLENLLSLWQKYEKQRSNFVSCLGKSESASKPE
SPYLSADKAKLRTELQDLQAFHSEVQVLEPAHAELFSLGTSLCPTAPEERVKQLKDELET
LQKRLHVQNEVLPQRIKEVQSHLSLLEEFDQALLKFSQWGEAMLSNLHSTSQINIAHLQS
ATKQVKETQVSLQKQSSVRQSLEQQTEKLCQFCEPSDAQLLRSRADSCLQPYLEAQHIAE
LQLECLERLEAFLQTHGVAAGVLQGLKQTVEGAGSWDRGKVEELQQELSTIVPDISRLET
LAVNLDSSLCKSHLNIVAEEGSRKSCRMLADSLSAELDAVRNLLGTKQSEAEALGSLWTS
FRQRKEQLLKAVEDIEEKADHQSFKEPSLHTLQQRLRFFNQLEDELQSHQHEEQWLRDKG
NQLAQRDAELAGEVLREISLLETTWDDTKKLITERQEQCNVLVGLMKEYQTLKSSIGSVI
ESTEPLVEISSVLKDHEETRRSLTKHEAVKVEMASKQHELDQFSSKGKQLVIELKKVPEC
HAEMMKKDMETLVDQWLDVSEKIDDNIDHLNQSLTLWEDVRKISEDTEIWASSCVIELNE
SLNNLNDSQKVSARLSILQAEMLEKEKRLETLQSKVSELKKFNQSQETPAKLQVLENDLR
KKISTVQKLHEQAGGNLMDFTSQKTQLEDYISQMSAWLKSMEDSLVSSPTGSDPEDICRV
KDLQKELQNQQGSIDSTRESLNTLCRKYPSEELAGLGSALTDLIKTYESVNQLSARTLAS
LQNCLQQQFNDLVQEFHRWLSEQREIVKECSDRSGDTQIVERKLQKLKGAMDRVEEGEVR
LTQVCEEGEKLLLHLPKASAGQVQQHLSSIQQDWDSFVEQCRQNQQILEDSASLMKGFEG
RLKKLRWWLEHMEKRMSTDMPEAKQCGPEKAALEQVEEYQQEVLKERDSFERLGQEGQAL
NEGGRGDGSETRVSAQLQSQHQALLRRVRERLRSCQLTLQEQQAFEDTLQTTWTWLHSVQ
ERLASLNSTVGNKETLEKRLSLVQDILLMKGEGEVKLNMTVGKGEQVLKHNGMEGQEAIC
AQLQSLKDAWANMLMTSMSCHSRLEWTVAQWSSFQESKSQVQQWMESVEQEVGMTLPQQP
GLKEKSALLERLRAIQADVEAHAAALSRLTDKAVEMHEKTGDQAFGPESRAELTAHFADI
SAVVKGKVQSMQSIVSEHEQYVDSVRDFNDWLISAKEELQRWSDLSGDSISIKRKLSKVQ
ELLDSKQRGRERLNRVQRCGAVSRDHTGSGGYEAMEREEAALLSSWDQWERGALQTRASL
ETALSQIASSEQEFSSLSAQLEQDLHDFSRQLKDWRLWLAQAERQNEGADAVKGWQIAKE
TLEELVKAEPASESLKTQLNDLCRFSRDMGTQSERVSALIKEYNSLSLQASKECQSKEKL
LEQGFRSVFREFQKWLVNAKISTAKCFDVPQNINEASSGLQKIQEFLTDRDQGQSKLNAV
VVNGELACSNAAKDKVDAVRAKMNMAREDWKNMMTSLHNRETSLQNVLSQMKDFEASAEP
LQQCLHATELAVHESCTRLHDLSAKKQELHKLQSVLEELASQEIQLNKLKEKAQLLWDEH
AAGKGFVHRVSQLSAQYLALTNLTKEKASRIERIATEHQLFSQGLKELQNWVADTSHMLQ
TYCAPTADKNVLDSRMIKLEALLTARQEKEIQLKMLITKGESVQRNTSAEGVPVLQKQIQ
DLKDSWDNLLSASIQCKSQLEGSLSQWTSYHEDVLQFVAWVERVEESLDPTDKQYPEMRD
KTANLSKAKLLLEEVLSHNTLLDTLTAKSDTIENYVTQLELQDLQERYSTMKDNAMRAVG
KAEELVKAHNEYQRDLQAFEDWLEQEQEKLGCYTQLEGDVDMLEETLQKLQELQLHCTEG
QALLNTLLVSRELVTPWGLPQIEDRALETLQQEWRLYQRRLADTRAQLNSALAKLRQMEQ
KFQRLDSWLKGMETKAQLRSHRRSDRATKDAQLQLIKSWQEEVLVYQEEMEGLSLLAQQV
LDETHISSRISSRATQITARYHILLLHLLETIKQLQEEVSVIEEARCVFNTFSDWLSAGQ
NNFSTVVISVDVVDRFAMDRKMKKLEALQADMEQGHSYLKTMREKTERAMVFLEEPEAEQ
LKEEVDSRLFQLKELMEALRTQHSALEKCISLSKDFMDKYKSQAQWMMETKNLLASSVEP
KAELYQKKAQLAKYKTIQQTVQSHESAVKSVFEKGEALLDTVHDPTISNNMKKMQADYHD
LCLAVKTQVQNLVEWVKEHEDYNSELQDVEKWLLQMSIRLVSSDSIQTSGMEMSTQQLAR
HKAIMEEIASFEERLTSLKQKGEGLIGSCSDQVQAKISQQVQAHQQGTRDSYSAICSTAQ
RVYQSLDRELQKHVNHQDTLQQSQAWLSTVEEELPLNDQGPSGLQEALKQVKHYRALQEQ
ASTYLDLVCSVCDLSDDAVRVTAAQIQHVKLTIEERMSSAKELSEGWREIKEQKQDLTSL
FQDMEQQLLSLSRRPAELETKIALNMLCQAKECSQHLQSKQSILTKMTETVSRLTGGQDS
PEHAELDRLGHSWLELCHQANKLQIQRQEDLQRSKEYHDCITAVEALFEQMSKEWDNLAR
TDAESSSQHLEALRKLAVTLEEQKGTLEDLKEQKQKVVQHLNLDDKELVKEQISHFEQRW
SQMQNLIERKIQDSVMTLEDMGQVEARLKEARDWAEEQKPALSEAMKMSPPPELAQSFLF
DHLSICSELEAKQLLLAQAMADADRVLARLGLSERQRLQQLIVDTQYEVESLSVKVVQRR
KHLSKAFTERTQFLMAVSQSITWVQQNEKKAQAEEYIALLPDDLAKQVRTCRNIQSSLKA
YQSELTSLWSQGRDLMRDASEEEKNEILTKLQELQNIFDKTLHRCGQKLQELEKVLVSRK
YFKTDLEKICLWIKQADIVTFPEINLMVGDAELETQLRKYQQIVEQAIEYENLLLIVQRA
GQEILPSLNEVDHCYLDEKLNTLPQQYNSILALAKEKQEKIQQAILTRNEYTSFIDVTHK
ALKELEDQYNNLGTQPVGLQTEEVVSLQSDYKTIQVDLSNLGLAVSELNQKKEGFRSTGQ
PWRPEEMTQLVSLYNSLKRLVEQKVEHLDDTLESFEDHKAMAMQVDSELKATKEQLVKVN
AETQSAEERLKNYHALAGSLQSANSHLSRLMEQMDTLAPRVEQAAHDASKEQVVLWQDEL
RSLQAAVGDLIEECENRFVQSKDFETEMKRTLDWLQQVRDDLGCAVIVDVRLERVQEEIR
KQQIMQEEVQSRLRIVAALSSREKQQFVSANELVPAHVDTSLEEMAKLQADVQKALSSKQ
QKITLEEALGLCQKYHFRMQSACEWLEDAVSFLQQASLGVDVENYEECLRQQGDIMATEQ
EFLVHLEELQGLLPQLEKLVNPTAKDQLRVSVDSAEQRGVEVRDQLQCHQDVLQSCVTQW
KSYQESRQTVIELMNEAEKKLTEFSTAKAATSQEAEDKLCSHRSLVSLVNGFQEKLSGLE
EQAAQLELVGSDASKATISRSMTTVWQRWTRLRSVARGRERVLEDTAQDWRTFREKMVKM
RAVSDELQSRFPDSAVEKASKATLQSLLDQHELLSQDLERELSSLTLLRQYALSLLHDVE
VPSPTTEQDERPSLKGIRAVQDQMESLLTQSRTKRAQTAQELRDREEVEKELSVVKAWIQ
ETRELLLNPTPDIDSLLQKLEVVHGEVITYRQNVDKLAEQQQSKYLDLYTILPSEISMQL
AEVSLALGAIEDQVLSKEREIQKTREIKEDFSSRIHGISEKLKAISAKFKEKSPDVDHAK
EEVKSLADELDCCGRALSDMDAAVQEFARRNPLLAKQLSDAISKLSEMHHQTTRVADCRN
NWLKKAVCYLDEYDEMLDFIVRWSEKAKSLVRANIIWNSSVHLQEQIRMYLAVLRESREL
HGDLESMAEKVDLLSEVLQVESKSQQVCELSRLTEELQQCIKTRLQSLEDADKSMEALEY
EVKALHVALEQVQATLTSPELARQSLKEQLAQRQRLLADMESFKQQVQAVQLCQSALRVP
EEVMPNLAICRTALRLQQEASQLQHVAIQQCNILQEAVVQYEQYEQEVRDLQGLIEEAHR
VIQDRPIPTNNIQELQAQILHHEELAQKIKGYQEQIASLNSKCKMLAVKAKHATMLLTVS
DVEGLPEGLQEMEGEKSKNSSAQAFMCQMTAGRCHTLLSPVTEEGEEGTNSEVSSPPVCR
SPSPITYTEAAITKQYLWFHLMGRGTLIRAPIQELYDPAFESVANLDDLQRSWETLKNVI
SEKQRSLYEALEKQQHYQGSLQSISSRMEALEAKLSEPLEADRSPDSHMQAQESLTKEMQ
SVQEEIDRLQTSFTEDLASDAVESDVADQLAMHSSLAVLAERMATIHMKASGKQQILEER
ISDRLEGQQQEQVIQLHNAQADELDLWLTRMRGAVTFILEPKPLDDTDMEDQLAECQNML
LEIEEKVLALSELSMHSENLLLEGRAETREDAEQLAGKLCMLKGSLLELQRMLQDKLVNI
QGSLQEQEDSESDSSLSQSPSVQDWLVQARTTRSQQHQDSLQRQRELEEQLAEQKKLLQS
VASRGEEILIQQASPSSASTSEPFSPAALAERESQAAREQLRQKWESLRLELKTKLQLLQ
KTLEQDLKQPVYSRASRVTTAGSLFKGETEAGKSSLNTLYDSFRQTMEDMPTQPCGDEAQ
VVQMEQQLYTAVSSTSCWLDGVENNVFSGSVLLVENPETQLQKQETLENDVRHVVEDVKL
SQALLAGSPGLRQEDRSLLEDNLGCLKERLGALGHALEQRGDHMRTRAHELTVYQTELQL
LQTALIETKCQILQALAGAMDRPASKQLEVIASAEESLKDFEQRITELKSRGASLQADQI
STNKILKLQDSYEELVMTVGSRRSGLNQNMALKEQYERALQDLTDLVDTAKDKMAADQRI
VASSVEEVENHLDKHKEFFQGLESHMILTETFFRKIRLLMLPKESQALEETLAEAQIVLK
EAHSKGVELECILETWCRLVQDYQSLNHQLEAVEGNIPSVSLVEETEERLMDRISLYQGL
KGRLTEYQHKLHQVLDEGKHLLLSVCCPALENQLALLGEHWLNNTSKVNKELQRLEAILK
HWTRYQRECAELSQWLQSALERLEFWNTQAVLVPQELETVRDHLSAFLEFSKEVEGKSSL
KSSVITEGNQLLRLKKVDTVMLRSDLARIDTQWTELLTRIPVVQEKLHQIQMEKLASRHA
ISELFNWISLMENVIEENEENLKSAVGSNVIQDYLQKHKGFRVDLSCKQLTVDFVNQSVM
QISGQDVESKRSDKTDFAERLGAMNRRWQVLQGRINERIQFLESLLEMWLEYESSVQVLK
SWMATQEERLKRKHRMEDLTSVQNALKDCQEMEELVKEKEKELERVEEQGCALVQNKTDE
ACAIVMETLQGVNHTWANLDHLIGQLKISLKSVLDQWSLYKRASEEINGYLMEGRYSVSR
FRLLTGSLEAVQLQVQSLEDLQEALEKQESSLRKFGAVTHQLLRECHPSVSDSLNNALKD
VNARWSGLLEEIAERLRSSKALLQLWQRYKELYERSCSSSQLQEEKADQLLKLACSKDIA
DEEVSDWIRECSEVLRSQAPAQASLQVLQQLGDQLKQQVDTSAASAIQSDHLSLTQRLAA
VEQALTRQLTALQTGVQDYEIFNDQLDSLGRWIVEAEEALKVQDPNGSTDPTVIQERMEE
PKRLMLKFSSMAPELERLNELGYRLPLNDSEIKRMQNLNRSWSTASSQTTERFSKLQSFL
LQQQTFLEKCETWMEFLVQTEENLAVEISGNYQSLMEQQKAHELFQAEMFSRQQILHSII
SDGQRMLEQGQVDDRDEFNLKLTLLSNQWQGVVRRAQQRRGIIDGLMRQWQRYREMVEKL
RKWLVEVSHQAEALQAGTAVPLQQARSMLDAVQLKEKVLQRQQGSYILTVEAGRQLLLSA
DSRAEVALQTELTDIQERWKHANVCLDRQKKELVILLRDWERCERGIGGSLEKLRAFKRQ
LSQPLPDHHEDLQAEQMRCRDLENTFDGWTGDLAHLNVLRESLSCYISAEDLSVLQERIE
LLHRQWDEIWHQLSLRRQQVSEKLNEWTVFSEKYKELCEWLTNMESKVSHNGDISIEEMI
EKLRKDYQEEITVSEENKLQLHQLGERLARASHTSKAAEIEQKLNKVNDRWQHLLDLIGA
RVKKLRETLVAVQQLDKNMSSLRSWLAHIETELSRPIAYDSCDFQEIQRKLDLQQELQRD
IEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRSLDRRWRSICALSMERRLRIE
ETWRLWQKFLDDFARFEEWLVTSEKTAALPNSSGVLYTVAKEEHKKFEAFQRNVHESLTQ
LELINKQYRRLARENRTDSSCRLREMANESNQRWDDLQKRVASILRRLKHFISQREEFET
ARDGILVWLTEMDLQLTNIEHFSECDIQAKIKQLRSFQQEISLTTAKVEHIFHQGEALIE
KSEPLDAAVIEEELEELQRYCQEVFGRVERYYKKLIRLPLADDDTEVSLSDRELELDEPC
DLSSLPWGERLGDGFLSPLPSSGRSASLAAQLRTERSGRDTPASVDSIPLEWDHDYDLSR
GLESASRVLREQHSEEGDFLQRPSSALSEKHAVLLSQLREVASTDSHVHSLDSSRFHLQQ
TDSGRSRTPTGAETDVSYLGYTRLLGECRGSIDTVKRMGFELKEEEETGSGLADPSSSES
QTSGVIERWELLQAQDLSKELRTKQNQQQWQQLNSDLNKVWTWLGETGEELEQQRRLDLS
TDIQTIEQRIRKLKELQKAYDKRKAIVMSINLCSAEFVHSATEESKVLQAKLKDMNNHWD
KLGSLLEQWRSSLQEALMQCQDFHEMSHGLLLWLENIDRRRNEVVPIDPIQDSDTLHQHH
KTLTQIRQELLDSQLKVASLQDMSLQLLVNSQGSDCLEAKEKVHVIGNRLKLLLKEVTRD
LRELAKILDITSSQQDLSSWSSADELDTSGSLSPASGRSTPSRRRSQRGKCSLSQPGPSV
SSPQHSRSRDAGSVSFHSDSETVGGSSFLCRVLWVALPLHLLMLLLVVFAFMLPMTEEDY
CAQSNNFAHSIYPMLSYTNGPPPV
Download sequence
Identical sequences G3PCF5
ENSGACP00000015279 ENSGACP00000015279 69293.ENSGACP00000015279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]