SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000016005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000016005
Domain Number 1 Region: 21-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-85
Family Calponin-homology domain, CH-domain 0.000018
Further Details:      
 
Domain Number 2 Region: 268-390
Classification Level Classification E-value
Superfamily Spectrin repeat 8.63e-33
Family Spectrin repeat 0.000000661
Further Details:      
 
Domain Number 3 Region: 504-625
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-31
Family Spectrin repeat 0.00000316
Further Details:      
 
Domain Number 4 Region: 391-499
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-25
Family Spectrin repeat 0.00000388
Further Details:      
 
Domain Number 5 Region: 628-740
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-23
Family Spectrin repeat 0.00000241
Further Details:      
 
Domain Number 6 Region: 739-842
Classification Level Classification E-value
Superfamily EF-hand 2.39e-18
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number 7 Region: 844-914
Classification Level Classification E-value
Superfamily EF-hand 3.71e-16
Family EF-hand modules in multidomain proteins 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000016005
Sequence length 915
Comment (Gasterosteus aculeatus)
Sequence
MYNMDHYDEEMKYMHQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIDNIEEDF
RDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGN
AKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGF
CALIHRHRPELIDYGKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDVISTLRPDEKAVM
TYVSCYYHAFSGKQKAETAANRICKVLAVNQENEQLMEDYEKLATDLLEWIRRTIPWLEN
RMPENTMQTMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGK
MVSDINNAWGSLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQK
HDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRI
CDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVH
TIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQE
VNAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE
MHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQ
LLTTIARTINEIENQILTRDAKGISQEQLNEYRASFNHFDRDHSGALGAEEFKACLISLG
FDIANDAQKRSGIMDAEDFKTCLISVGYNLGENEFSRIMSIVDPNRMGVVTFQAFIDFMS
RETADTDTADQVIASFKVLAGDKNYILADELLRELPPDQAEYCMARMAPYTGPDGVPGAL
DYMSFSTALYGESDL
Download sequence
Identical sequences G3PEI1
ENSGACP00000016005 69293.ENSGACP00000016005 ENSGACP00000016005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]