SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000018331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000018331
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Globin-like 1.32e-28
Family Globins 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000018331
Sequence length 89
Comment (Gasterosteus aculeatus)
Sequence
PDVQKHGRTVMAGVGDAVAKIDDLKGGLLNLSELHAFTLRVDPANFKILSHNLLVVMATM
LPNDFTPEVHVSMDKFLAAVALALSEKYR
Download sequence
Identical sequences G3PL51
69293.ENSGACP00000018331 ENSGACP00000018331 ENSGACP00000018331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]