SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020505
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.23e-42
Family Calponin-homology domain, CH-domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020505
Sequence length 317
Comment (Gasterosteus aculeatus)
Sequence
TMSFNKGPSFGLSAEIKNKIAQKYDSQKEDELRVWIEELTGASIGSDFQKGLKSGVILCT
LINHLAPGSVKKINQSALNWHQLENLTNFIKAATNFGLKPHDNFEANDLFENGNMTQVQT
SLLALASMAKTRGCHSRVDIGVKYADKQERMFDEEKMKAGQCVIGLQMGTNKCASQAGMN
AYGTRRHLYDPKVQIQPPMDNTTISLQMGTNKGASQAGMTAPGTRRAIYDQKLGTDKCDN
STMSLQMGYSQGANQSGQNFGLGRQIYDAKYCPKAGEVAEDQNGAGVVPDYIPDFQDEGY
QGYQEEEQVYREEGTDY
Download sequence
Identical sequences G3PSB9
ENSGACP00000020505 ENSGACP00000020505 69293.ENSGACP00000020505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]