SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000020947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000020947
Domain Number 1 Region: 10-162
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.96e-54
Family TRADD, N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 204-284
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000396
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000020947
Sequence length 299
Comment (Gasterosteus aculeatus)
Sequence
MAYKTVDGGPWTGCAVLFLRSLCPGVNLLSLFKDREQGKFVVFKVIKLTLTDSAGGLGGH
EILKIHDADPFLGVEVKFNDMLACRQFLESYSSGAVRQSLSQHAGRLLTLPQEFTVETQL
KASAHILDLCLDQLELCLQHVHLSQPERLRDEEIEHLEKQLEIQARGSEPQPDPPTQEEC
PVPSHCFKFQNKPTEDRMLTGGDVQSFSSGVGRQWKHVGRALAKSCQALKGPAIDNLAYE
YEREGLYEQAYQLLSRFIQAEGRAAKLSRLVKALEDCKLTSLAERNDLLSLFNGHTVLS
Download sequence
Identical sequences G3PTL1
ENSGACP00000020947 69293.ENSGACP00000020947 ENSGACP00000020947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]