SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021045
Domain Number 1 Region: 13-145
Classification Level Classification E-value
Superfamily MAPEG domain-like 5.36e-38
Family MAPEG domain 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021045
Sequence length 154
Comment (Gasterosteus aculeatus)
Sequence
QTNHSMAAPITSEAFSCFLFYGVLLVVKMYILAIITGQVRLRKKAFANPEDALRHGGLQF
HREDPYVERCRRAHVNDMENILPFLFLGAIYSMTGPCLAVARTHFLVFFVARCLHTVAYL
FGLKAPTRSLAYVVAQIPCVSMALQILAAVAAYA
Download sequence
Identical sequences G3PTV8
ENSGACP00000021045 ENSGACP00000021045 69293.ENSGACP00000021045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]