SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000022620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000022620
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-17
Family Calponin-homology domain, CH-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000022620
Sequence length 1021
Comment (Gasterosteus aculeatus)
Sequence
LQAVTGKSFGDQDFRSGLENGILLCELLSAIKPGLVKKINRLPTPIAGLDNLSVFLRGCE
ELGLRGSQLFDPGDLQDTSIRANLKDSDCNRKIKNVLNTVFWLGKAASGCASFSGPTLNL
KEFEGLLAQMKVECEEGGDSSLKRSVRDSGYDCWDSERSDSLSPPRHTRDNSLDSLDSFG
SRSQHSPSPDVVNRGSADGRGSDSEADGSSRRPDVRKDDMLARRTASGDSRISVPFNQFL
PNRTNASSYIPTARRRPHTEEVRPRRTSRRMTWPVGGVRREERQPPSVPMSEDTESVSMS
DILNEEEVEHLPPLSQSRNERMHEPYNNFEEDDDHWQNDLARWKNRRRSASQELIKKEEE
RKRIEKRMKEEGGDGNKRKSIKTYKEIVEEKERREAELCDAYRNAASPEEAAMVLQRYAL
RFTISDATLDSLKLPRSKQDLHRADKEHGTSPTASETRRPPHTPEPPVTKPQRHRRPEAS
ETNPSGTQPGHGLPSPPSVASRPVPLLAAKPYCPPPAHKAVKMDGLVRVNGEVTEDLSVS
TPPTSARQSPPEVKDNPSKTTEEDVSSEETVKDVPLEKTQKDVPLEKTVKDVPLEKTQAD
VPLEKTVKDAPLEKTQADVPLQKTVEDVPLEKTQADVPLDKTVKDVPLEKTQKTVKDAPL
EKTQKDVPLEKTKADVPLDKTVKDVPLEKTVKDVPLEKTVKDVPLEKTQADVPLEKTLEN
LSSEPLEQTDLAKRVNHWVWDPNEERKRLESWQQEQERLLQEQYQREQQKLKQEWEKAQV
EVQEEERKHNEEERRILEETGTPLSPSGLLSQQTGTTAPPPGNNETEKCKVTPQQNGQRT
SAGSEDQHASKLHFFQGEIPSEYTLLWPHCAFDGEPLKKQELWKTASLDRNPQLNPEHVA
KSDINAKHVELQCYLPQRSESHDAVTNKQQPSPSSPQPPSPSRCVSGKRLCSGCSQQLEK
GAAMIIDTLGLFFHIQCFKCGVCHGQLGDATAGTDVRIRNGLLSCHECYIASRGRGQPTT
L
Download sequence
Identical sequences G3PYD0
69293.ENSGACP00000022620 ENSGACP00000022620 ENSGACP00000022620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]