SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000023064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000023064
Domain Number 1 Region: 36-163
Classification Level Classification E-value
Superfamily BRCT domain 1.18e-36
Family 53BP1 0.0000101
Further Details:      
 
Domain Number 2 Region: 178-277
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-28
Family 53BP1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000023064
Sequence length 280
Comment (Gasterosteus aculeatus)
Sequence
KRGRRGSGGRAAQRVGVCNTSGSGTDLPAPSGEAAETHGPLPQNTTLFMGFAFMLTASSE
IDRLTNRPASDDEDDYVQTGPYNKAYTESQLQAGGGFVLQDFNEEQCKAAYQSLLIADQH
CRTRKYLLCLASGVPSVSHLWVRDCCRENKLLNYRNYLLPAGVGPDEALVEWHPRCSPFK
ALRVLLVFEKPVELWVQLISMGGGSSVRQFPADKDSSDIPAGRYEVVVTDSSCPAWVETE
VTSQDVPLVSPEWLIQSVIRGECLGFHSKPQYRHDYASTS
Download sequence
Identical sequences G3PZM4
69293.ENSGACP00000023064 ENSGACP00000023064 ENSGACP00000023064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]