SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000024103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  69293.ENSGACP00000024103
Domain Number - Region: 34-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0136
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000024103
Sequence length 768
Comment (Gasterosteus aculeatus)
Sequence
LLHSSTDWVDVANDLLCKCPIKLRLRKLTDCNANVFIALYENILGEKVPDYIAVPCSQED
NVHNVQSVIDSLSLDYLQISLSHITGENVVGGDKDSIKNLLEIFDGLLEYLKEEISEESQ
NELNGRVNDDVPDETKEPSSCKATQQKETKLDGESLSAVHSSKDSLHTWNAEEMGSTSEL
IGLGVSARTFTAKPEGKTHAVPLSGPLDAPLTEPLPLTIALQPPSQSDTPHRPVAGSAGL
RPGPVEEGVAPVPTEPTDKGPRRVLFRTKPDVLFLTLHDERTVTTPSVPDAEEEEQQPDE
DYLGLSEEPLSCRRQRNKQAEEELQHISENLSHRLEELDQMLKRVLGETGESGEVREEDK
QSHHSDSIMECGRTPRQHTETADGEATHRTRSLSPSPPRLRRSLHGQSNDAVAEAWSRDR
ILLFQYVENEAYEEELKRYEDKERADLDKARLKAQQAERQYREALLKDVSEEPRLSPART
KTQRSSHRDAQTTTGRRLAQRKTSMKVKENELLPVLLEELPHLHISPRALGRMWEQQMQQ
VDRLHALSAPHSQRRSKLSSQVEEAQKKHDLLVEILRKDKDHNRRLRDFKERIQQQKSTQ
NRLRDQRQQVARAKKYHSDYHVQHRARLMRARTKEERMFRQLFEEGLELQKVRLREQKAH
AKEQRLEHQRRHQNQIKSMENYYKDQFSLLAEKLSEERQEIQVRKKAQEKALLKMKRELR
SRMEREIGELQKIIVQNDEDDHFQDLEVQTLRNRVQMASFQYNTSYLH
Download sequence
Identical sequences G3Q2K4
69293.ENSGACP00000024103 ENSGACP00000024103 ENSGACP00000024103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]