SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000024802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000024802
Domain Number 1 Region: 91-183
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-22
Family SCAN domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000024802
Sequence length 197
Comment (Gasterosteus aculeatus)
Sequence
LGEALSKPHSTGCSKVALTMVRLLPKFNERDPDIFFSLFESVADDRGWTDSERTLLIQSV
LVGRAQEAFIALPVPDRKKYVKVKEAVLKMYELVPEAYRLRFRSWRKGEKQTYTEVAREL
YSHFNRWCSAVGVTTFEELSNLIVLEQFRNILPERVATHIFEQKMKTAAEAAVVADDFAL
THKYSLKDTGQIYQEKR
Download sequence
Identical sequences G3Q4J8
69293.ENSGACP00000024802 ENSGACP00000024802 ENSGACP00000024802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]