SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000025746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000025746
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-31
Family Calponin-homology domain, CH-domain 0.00098
Further Details:      
 
Domain Number 2 Region: 1934-2071
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000364
Family Nucleotide and nucleoside kinases 0.088
Further Details:      
 
Domain Number 3 Region: 1963-2010,2081-2168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000636
Family Nucleotide and nucleoside kinases 0.068
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000025746
Domain Number - Region: 1480-1553
Classification Level Classification E-value
Superfamily Tropomyosin 0.053
Family Tropomyosin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000025746
Sequence length 2299
Comment (Gasterosteus aculeatus)
Sequence
QIYTDWANHYLARSGCQRLIKDLSQDVTDGVLLAQIIQIIANEKVEDINGSPRSQSQMIE
NVDACLSFLDARGVNVQGLSAEEIRNGNLKSILGLFFILSRYYYQSLVELSQQTSSGAPT
AGGPRTQEMQSSLTARYASPPGHSGIGSPQKKNTRLTGDCCVPKKICATEINSSVNIVSE
SERFSSIQDKNRTPAFLRVFFKNGGHGRMNGSGTGGTVPTSLSGQQLASAIPSHAAGKSW
RSKSMNLKHSATSSMLASPTHSPILSPQASEGLHPHGGDGSKAGSAGSGGAQRSMLEKFR
LINPRSASRASASVAEMSLQEEDDMLEYGEEELTPTGSVCSSSGNNATSKQMSTKTTAPS
LAAPTSANGSRSVASSKDKEDRGRSGKSSKDSSPPKEERESFADPTKKTSKIASLIPKGG
KPSSGKKDGGTSSATSSIPKSGLKAPSQTASKPQSQATLNSSGNMRGGEGDRAKLTKGGQ
GGSFYIQRPGGGPEGKRTSMTSSTSTSALSGTSGIMGGGALGGNGVVQLPQQQQHNHPNT
ATVAPFMYRTFSENDCTMVAPADPCLSPTKGELVYSKTAKQCLEEISGEDPETRRMRTVK
NIADLRQNLEETMSNLRGTQISHSTLETTFDTTVTTEVNGRSLPALTTRSSPMAWRLGQT
QTPRLQAGDAPSLPSSYAAPRASTTSAGTTTGRYSGHSDPSRFVYSAPLRRAAAGGRGAE
QGESAAGGKQMEVAGYVSDGDILGRNGRTDEITSGYLTDGGLHLYARNAGRASDPAAPSR
EASQRGSKEMQGDIDSWDDSSSVSSGLSDTLDNISTDDLNTATYSAASSSRKTKDPSPPQ
PQSQKGSRSKHAEQEVSSSWAGAEDLKKVEEELDASMDPGSGSSRWKPSSSSSTAQAQSQ
YEDAGQKATQTGSWRRGMTAQVGITPPRTKGASAAHKTPGKTDDAKASEKGKAPSKSSPA
IQRSPSDAGKSSGDEGKKPPSGIGRPPTTASFGYKKIPGSSGTLITSSGATLASGSATLG
KAPKSSAALGKGTGIGGVRKTSLDGTQPQDDGVLLSCSASKVTLQYRSLPRPAKSPSGTA
AGRGGHRSSSTSIDSNVSSKPAGTAPTQAGAKRRDGKVGSDRSSPITINQTDKEKVAVSD
QDAASGLSTSPKSSPTSSSTSQSGLRQPGSKYPDIASPTFRRLFGTKASSKASSPGTPDS
GKCPSILGSPHGTLARQASLDSPSSGTGSLGSAGGLSGGSSPLYGKTPDLCTDSPASSPA
SGLSLPSNARPWPACSSSAGSKDTLSCQSMTSLHTSSESIDLPLGHHGSKVTRTGSVKST
LSEGMPLDRNTLPKKGLRYPPSSRQTSHEEGMEWLRSHSTGGLQDTGSQSPLSPPGASCT
NTGKYHYSNLLSPTNICQYNLQPGSTNMSRSNSIPAQDSFDLYGEGHPLGGSATSLEDRP
GRGISRSGSFRDSTDEVHGSSLSLVSSTSSLYSATEEKAHSEQIRKLRRELDASQEKVAT
LTSQLSTNAHLVAAFEKSLSNMTCRLQSLTMTAEQKESELVELRETIETLKTQNTDAQTA
IQVALNGPDHLHKDLRMRRQHSSESMSSINSAASHSSMGSMGKDAEDKKKKKKSWVATKV
RQLLRSSFKHAFSKKKTKSQSAHDEMEETIDSLPSSPKLQHNNRQGSIGTLHPRPSTHRS
RSSPIWTPKKRPNGHVVYKHRSRLCVCVFGITLEVTAHEKEIETSDEMLSPTSGDHMIHK
IRKTIKDKKNEIEALKAENDRLKSSGNATPTATPVKAARPPSETSSTSSSSSRQSLGLSL
NNLNITDTIMSDILLDESYEGNLRKEGRSVRIVVTICSGPYTTKGTDDQAHLIGSIGVSG
KTKWDVLDGVIRRLFKEYVFRVDPHTSLGLSSDSIVSYRIGEVVRSHASEVPELLPCGYL
VGDNNVIKVNLKGVKENSIDSLVFDTLIPKPVVQRYLNLLMEHRRIILSGPSGTGKSFLA
AKLAEYIISQMGRPVTEHNVASFNVDQNSSKDLRQYLSNLAEQCNSEETDTELPTVVILD
NLHHIGSLSDIFNGFLNCKYYKCPYVIGTMNQGVSSSPNLELHHNFRWVLCTNHTEPVRG
FLGRFLRRKLIETEIDKSMRSNDLIKIIDWIPKTWQHLNGFLEAHSSSDVTIGPRLFLSC
PMDVEGSRVWFTDLWNYSLVPYLLEAVREGLQLYGKRATWEDPSKWVNDTYPWNAASLQV
DGQSLLQLRPEDVGYDGYSSSKEGASSKQVSQSDTEGDPLMNMLLRLQEAANYSSTQSCD
SDSTSHHDDQLDSSLESAL
Download sequence
Identical sequences G3Q786
69293.ENSGACP00000025746 ENSGACP00000025746 ENSGACP00000025746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]