SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW003394-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW003394-PA
Domain Number 1 Region: 358-598
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.06e-30
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 54-209,354-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-19
Family HI0933 N-terminal domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW003394-PA
Sequence length 610
Comment (Ixodes scapularis)
Sequence
QMCDVLQLSPSPLPAFYPRLKAKLRSWRAASLWAKLDKRAAHKCYNRGKACAGMRVLIIG
GGPCGIRVAIEAQLLGAKVVVLEKRDRYSRNNVLHLWPFVIHDLRALGAKKFFGKFCAGS
IDHISIRQLQLILLKVALLLGVEVHENVTFKDLLEPPEDQSQERIGWRAQVLPADHPASQ
YEFDVLIGADGKRNTLKGKCRFNRKEFRGKLAIAITANFMNRHTLEEARVQEISGVAFIF
NQKFFQDMRESTGIDLENIVYYKDDTHYFVMTAKKQSLLDRGVIIDDYSDTASLLSPENV
DRAALTEYARDAADFATGYALPSLEFAVNHYGQADVAMFDFTSMYAADNACRLLERRGHW
LLQGLVGDCLLEPFWPTGSGCARGFLSSLDAAWMMRSWAMNKDSPLHVSVFGVLLRCLPL
PNYFMSNVRENILCFFFKTDFTMEGFCCMHQLMCIIPYEGSITGYCKVPQVNLTSLAESL
RHTFFCFWAESIIHPDALLSWCQRQVALYSRIKIENMTTSWKDGLALCAILHRYRPDLID
LDELSADNIAANNQRAFDVLEREYGIPPVMTGQEMVDCAVPDKLTMVSYVSQIYETFRRE
IPQGELQVAR
Download sequence
Identical sequences B7PCL3
6945.ISCW003394-PA ISCW003394-PA XP_002409960.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]