SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW004232-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW004232-PA
Domain Number 1 Region: 3-38
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000012
Family D-aminoacid oxidase-like 0.008
Further Details:      
 
Weak hits

Sequence:  6945.ISCW004232-PA
Domain Number - Region: 19-86
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00188
Family D-aminoacid oxidase, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW004232-PA
Sequence length 97
Comment (Ixodes scapularis)
Sequence
MQVSQHDRKYIWENCVSVVPSLKDGKVVQDWVGLRPFRQPIRVEAELLGFAPNQCKVVHN
YGHGAHGVNTSWGTAMDATHLVESLLQDSLTAPVAKL
Download sequence
Identical sequences B7PI83
6945.ISCW004232-PA XP_002404662.1.51680 ISCW004232-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]