SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW004683-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6945.ISCW004683-PA
Domain Number - Region: 38-79
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0177
Family DBL homology domain (DH-domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW004683-PA
Sequence length 277
Comment (Ixodes scapularis)
Sequence
MKEYWTFLELQSNDSYADDAQAYGAGAVEAYLTHDLMEKQFKNMYSRYCNNQHEYCERLS
KFLLENLKYSNSQEHLYESTDPYWHMVHLQMKQLAGLSDHFENKTLNVSNEYLNVTRALF
FNVEGDLIDLEGVLRRVHDENSIDQTPACSALIKVVADNDDILFAHDTWFVYRSMLRIEK
KYMFPWHFTSKSRKTIPGHTISMSSYPGKLVSLDDFYLASSGLAITETSIPNNNDNLWNL
VKPDSGPLTWVRGMVATRLAVTGSQWVDYFGKLNSGT
Download sequence
Identical sequences B7PJF5
ISCW004683-PA XP_002407855.1.51680 6945.ISCW004683-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]