SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW009822-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW009822-PA
Domain Number 1 Region: 916-1042,1074-1278
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-59
Family p120GAP domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 25-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.81e-32
Family Calponin-homology domain, CH-domain 0.0000451
Further Details:      
 
Domain Number 3 Region: 1479-1576
Classification Level Classification E-value
Superfamily RGC domain-like 1.83e-27
Family RGC domain 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW009822-PA
Sequence length 1576
Comment (Ixodes scapularis)
Sequence
MDEEAVGSMASRASSDTMDLQRQEQVAYEYLCHLEETRAWLSACISQELPGPSALEESLR
NGVYLAKLAHFFAPDVVPLRKVYDADESVYAERGLRFRHTDNINHWLAAMRAVGLPQHFF
PDAFDLYEKRNLPKVIYCLHALSLLLFKLGKAPKIEDLVGKLSFSSSQIDEVRLALQERG
VELPAFGKIGGILAREMSADDAALHVAVILINKALDDEDPEAMVAALSDPRAELCAVRDT
NASRYLQVLRVAKQVKLENHLERSLDGSYVADVYDEMLNQAEIQGYVFETNVNVLLEQLD
KAIKEDDLEVFGTLIGSPDLGVSNVVPENVAGYLEVLKKIREDTDDEAFVLSKSDLQVAV
TASNEKVDLENAQEEAIIAINNCLKGDDAEATFRALQNPAAALPEVYPLVSGLYHSELAS
IRNEAGHNLDRNELINGLCILSAIAEVNFSLRMKGSCDVVESLRKPSAHISGVNEGRTSR
YMGTLLQELSNKSKGDSTGTYLTHTEIQNCVDTANSRADDEHDKEKAVQWINQAVASGNA
SKTVDALLKKAAMILCVDKAQEKVYQLFLATKQVGQENAFLTVDDIQHEVNSANTIATES
NRICVSLATVHMGVVHRNADDVLNGLEALDSVKVIPGCKKLYLKELQRSSTESKDSEEPL
EWLSCFVQPNLHFNFNLLTLHSEWSDSPYGSLDSYMSLDKVTKLVEDVNNRFLSEDFIPL
WVNFQAASRGWLARRPADELRKRLARIISFRIDTTDSQQVRASPRKLRRSDSFIAKLQSH
IRGFLTRRRLHVSICHPEVEKESCQELLNQAHLPLIREFLHSLDVSAHDFSQEAELQKVK
SSVVASIRHNNALEKEVDAMDVKIGLLVRNCITLGQVMQHTGKKAKRDSLLYQTSWLKTT
QSLTSLSKESRERLAAYQHLFYLLQTDPTYLAKLIFAMPASRSNKFIESVIPSIFNYGSS
PREEYLLLMLFKSALEEEIKLKVQNPADILTGNPLVLKMVVDFYRTGRGQGALQDLLKPL
VSSVLDDPDLSIDLSPVDVYKKWINEIETKTGKPSGMKYECSAEDAIQHPEVQERLSESV
VQLEKLVSTFCTTITKSQDKVPYGILYVAKVLKNSLHLKFPHLPEEELLKYVGNLLYYRY
INSGIVAPDSFDIIQLSPGTTLTTKQRKNLGLIAKILQLAASGKTYDNDQHLRRLSVLTR
SCNLIFQEFFREACDVTSPEEHFGIDSYTEASLLTPPTITLTLQELRDTHQLLLEHKLDV
APDSFDVLHRLLDDIGKLPTDDELLGPLGGTSSRKVENTELCLTLTQKYTDEEDKVQLLY
SETKQMVVRLIRYRLDARTAREVLCSPVTEEEDQLYQSCSSPETVEARKKFQTLQDLHQM
ALESVKALQKVGRLPADDTYMGYILEDIAKDIVQQREYRRSREQELRKLQQTQRDLDRKT
AFYEEKLDYYQQYVQACLNNLINKGPKKGHQAPKLRTSSLKYTGAQLADKGVLLSVDGLE
PSQLKNAHFELSPREQQGVFSVRARFLGVPVDAADIDIQDLLQKQYEGVAVMDVFGKARV
NVNLLLYLINRKFYGK
Download sequence
Identical sequences B7PYN3
XP_002403401.1.51680 ISCW009822-PA 6945.ISCW009822-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]