SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW014071-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW014071-PA
Domain Number 1 Region: 78-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 5.23e-20
Family ISP transmembrane anchor 0.00031
Further Details:      
 
Domain Number 2 Region: 132-205
Classification Level Classification E-value
Superfamily ISP domain 0.00000000611
Family Rieske iron-sulfur protein (ISP) 0.00043
Further Details:      
 
Weak hits

Sequence:  6945.ISCW014071-PA
Domain Number - Region: 1-41
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0634
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW014071-PA
Sequence length 229
Comment (Ixodes scapularis)
Sequence
MISVKGRAPQVVQYVKASSKTVASQVKPLVPTVTIAEGEKVPPLPTKKSHYALAKSLPTR
ELFASSGSFKAGVQIRMAHTDLKVPDFSPYRHKLTSDPTKPARDTETPRKMHSYLILGAG
ALGTTYAAKSLVTQFVMALSASADVLAMAKIEVKLGDIPEGKNATFKWRGKPLFIRHRTP
DEISREGSVDLSSLRDPQHDNERMQKPEWLVVIGIYHALFSRGTTPCCL
Download sequence
Identical sequences B7QKP2
ISCW014071-PA 6945.ISCW014071-PA XP_002415747.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]