SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW016704-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6945.ISCW016704-PA
Domain Number - Region: 28-63
Classification Level Classification E-value
Superfamily Elafin-like 0.0314
Family Elafin-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW016704-PA
Sequence length 76
Comment (Ixodes scapularis)
Sequence
MYNCSTVCDAKYNCDLPSCNKQLDEEVCLLYAGFERTCYVDAQCAIQSRCCLGGYMNCES
KCEGPDTPDEDAPPTP
Download sequence
Identical sequences B7PAS8
ISCW016704-PA 6945.ISCW016704-PA XP_002407144.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]