SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW020875-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW020875-PA
Domain Number 1 Region: 933-1059,1091-1295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.51e-56
Family p120GAP domain-like 0.00075
Further Details:      
 
Domain Number 2 Region: 21-171
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.28e-32
Family Calponin-homology domain, CH-domain 0.0000442
Further Details:      
 
Domain Number 3 Region: 1518-1614
Classification Level Classification E-value
Superfamily RGC domain-like 1.24e-23
Family RGC domain 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW020875-PA
Sequence length 1614
Comment (Ixodes scapularis)
Sequence
AMEDGGRASSDEMDDKRQMEMAYHYLCHLEEARLWLSSCIEEELPAATQLEESLRNGVYL
ARLSHFFAPGEVPLKRIYDIDQTIYSGRGLCFRHTDNINRWLNAMRAIGLPEYFFPDAFD
LYEKKNLPKVIYCLHALSLYLFRLGKAPKIEDLLGKLNFSDDEVDQVRRGLGLNAELQMP
AFCQIGGILAKEMSADAAAVVAINTAIDRQELDLLLEALSAPSAQLREVHSENTSRYQAV
LEKAKRMKSDNIEIRSLEYAYVPDMYDRLLSLAEVQGYILETNVNVLLTLIGEVIEAEDL
DRFRALVLSRPDLGIQDVIVDNVPAYFQVLLKIRDDAYSNNNVFSLLRSDLQIAIHLANE
KIEEEMRVEEAVEAINVCLDCDEADNTLEALRDPGANLPLVYPLAARLYHSEFSFIRKEA
GHNLCHEELVGGVRILNAIAEINFALKSNGTFDLVECLENPNAHIADVRPQNHDRYAVAL
AAALVEKTKLSPAVVFLTHIDIQDIVSIVNAKVDNELSHEQALELINEAVMSSSASLVLE
ALLNPAATILHVSRDHMLLYQDLLFLKLQSLEERPLTEDDVQGVVDTANQVAFEASNMCI
GLATLNVGVCNQVVEDVRSGLESLKIVELRTDATESYLKELQRIFLRKFGDGSSIEWFSY
LVRPRLFFNLNVVQFRSEWASAPKADCNLFLSLEDIQRVVTQVNEQLKELQDISAIEPMI
IKLQARMKGYLIRSAVREQYVFYCEHIGSIIRIQAWYRSMRERVRYKKMLYELDALVPFV
TRLQSYVRRYLVHQKINDLINHYKDNERIATVVQTHYRSSCALRDYRLLTRATPSFPVLV
KFLHMLSVSEHDLAEEMEVQRVKERVVATIRHNQSLEKEVDQMDIRIGLLVRNCITLEDV
MSHSKREAVKSDWLGSSGGLTALSHQSREKLVAYQHLFYLLQVEPSYLAQLIFVMAPHNT
NNFVETVIYSVYNYGSTPREEYLLLRLFRLALKEEVRSSLSHPSDILKGNPMVIKMAVGF
YRTKRGQSCLEQLLAPLVKDILSDQDLDINFYPVDIYKQWVNQVETASGKTCGLSYEVTE
EQALQQSEVCRRLHESVLQLEAKALMFAKSIADSEDKVPYGMRYICKVLKQALEETFPDA
APTEVLKAIGNLLYYRYINPGIVAPESFGIVELERYGQMSHRQRRNLGSISRVLMFASSG
IPYGHQHSYQIRLNKLTASCGDILHRFFLEACDVVEPEAYFNIDTYSEATQLTPPTISLT
AVELRDTHKLLLEFRNDIAPDPKDPLHILLQDLGPEPTIEDLLGPANDSPDLAVFSKTKL
SLTLSSKFSEVQEDTPESDYLVKETKQMLVELMRTFRSCKTIHEMLDSDIGPETEREFLE
AQAAGRQPVRTSTASLLSRRKFGSLAAFRKAVVHNLEVLEERGVASSKDDYQDLLNSIAM
DILQKRNHRLNRQRELGYLQTTQQKLDAKTRSYQETLDYYSQYVQACLSNLAGGKSRRQS
MGGRRQSMASQRQSRNVLKYTGWKLHEKGILLEITGLDIAMLKNVSFEISPTNRTGIFSV
RSRFLGMGADEITLDIQDLLRQQYEGTAVTSLFGRAKVNNNLLLYLLNKKFYGK
Download sequence
Identical sequences B7Q1I5
ISCW020875-PA 6945.ISCW020875-PA XP_002409710.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]