SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW021585-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW021585-PA
Domain Number 1 Region: 10-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.25e-88
Family Calponin-homology domain, CH-domain 0.00000186
Further Details:      
 
Domain Number 2 Region: 272-392
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-32
Family Spectrin repeat 0.0000891
Further Details:      
 
Domain Number 3 Region: 1204-1357
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-27
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 4 Region: 1576-1678
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-25
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 5 Region: 1416-1569
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 6 Region: 611-729
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-25
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 7 Region: 1822-1948
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-25
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 794-930
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-25
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 9 Region: 990-1111
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 10 Region: 394-510
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-23
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 11 Region: 1120-1239
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-22
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 12 Region: 2089-2202
Classification Level Classification E-value
Superfamily PH domain-like 8.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 13 Region: 503-616
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-16
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 14 Region: 1681-1786
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 1929-2041
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000209
Family Spectrin repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  6945.ISCW021585-PA
Domain Number - Region: 1790-1830
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00816
Family Spectrin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW021585-PA
Sequence length 2234
Comment (Ixodes scapularis)
Sequence
MEAYDYDGGNSSSRLFERSRIKALAEEREMVQKKTFCKWVNSHLVRANCRITDLTMDMRD
GKMLIKLLEILSGEKLQKPTKGKMKIHCLENVDKALTFLKEQRVHLENLGSHDIVDGNSR
LTLGLIWTIILRFQIQDITIEQVDNQETKSAKDALLLWCQMKTAGYPNVNVRNFTTSWRD
GLAFNALIHKHRPDLIQYEKLSKSNAIYNLNNAFNTAEQKLGLTRLLDPEDVFVDNPDEK
SIITYVVTYYHYFSKMKAETVQGKRIGKVVGCAMENDRSIEEYDTLTSDLLRWIEQTIEA
LSDRNFANSLVGVQQQLLAFNTYRTAEKPKKFEEKGNLEVLLFALQSKMRANNQKPYFPR
EGKMISDINRAWERLEKAEHERELALREELIRQEKLEQLAARFDRKAGMRETWLSENQRL
VSQDNFGTDLASAEAAAKKHEAIETDILAYEERVQAVVAVARELEAEGYHDVDRINARKD
NVLRLWNYLLELLRARRARLEGCLTLQQTFQEMLYIVDCMEELKGRLASPDLGKHLMGVE
DLLQKHSLLEADVNVLGERVKAVVGHAQGFLGEEPQATGARSVDPRLVAERTQQLEGAYS
ELVRLALERRKRLEDSRRLWQFYWDMAEEEAWIQEKDRILSSLEIGHDLTMVHLLISKNK
AMEDELAAHEQQLMEVVRAGESLVAEGQPGSERVSQRTAEVLSAWDHLRELQALRAQRLA
QALDFHQFFADADDVDTWMLDTLMLVSSDDVGRDEANVQSLLKKHKDVMEELKSYTGAID
ALHAQADALGPADRESPAVLERLASIDHRYKDLLDLARLRKQRLLDALSLHKLFNEADGV
HQWIQEKDKMLESMVLTRDAEDTEVMRHRFEGFEQEMNGSASRVAVVNQLARQLLHVEHP
NSEQVLEKQNALNQSWAALRDAAEKKRENISSAHGVQTFHVECRETITWIEEKTKLLQAT
EDLGDDLTGIMTLQRRLSGMERDLAAIQAKLDALDKEAERIKQEHPEEADAIQERILQIK
TVWEQLTQLLKERDAKLEEAGDLHRFLRDLDHFQAWLTKTQTEIASEDEPTSLQEAERLL
EQHRLIRQEVDNYTDDYAKMMEYGERITADAADEDPQYMFLRERLRALRDGWAELTQMWE
NRQALLSQSLNLQLFQRDAKQAEVLLSRQEHHLSKDETPTSLEQVEDLMKRHEAFLTTME
ANDEKINAVVQYAQRLCNEGHFASDKIRKKADSILERRDANRNQANDQMAKLADQHALHQ
FLQDCDQLNEWVQEKSIIAQDETYRSAKTVHSKWTRHQAFEAEVQSNKDRLYQVQQAGRA
LVAEKPEMAQLVEPKLAELGQQFAALEDTTKEKGLKLFDANRQVLYEQTCDDIDSWIDEL
ESQVLVSETGQDLTSVNLILQRQKDVETQMAQKARQVDELQNQATYLQKLDPQKTEDIIA
KRSVVEQRFERLQAPLMERRNQLLKKKEAYQFRRDVEDEKLWVREKMPLAQSPDRGASLF
GVQMLRKKEQSLRNEVDNHEPRIVSICENGRKLVAEGHEDAAEFDRLVKELEDLWAKLRD
ALDARRRDLLVSEKAHQYYFDASEAEAWMSEQELYMMVEDRGRDEISAQNLRKKHQNLEG
AVDDYADTVRQLGDTARRLVQEEHPDSDQITVRQSQVDKLYAGLKDLALERRQKLEEALR
LFGLNREVDDLMQWIAEREVVASSQELGQDYEHVTLLRERFNAFRDDTKAVGEERVQRAC
AQADALMSQQQGTGGDAATAAQWKDTLQDAWADLLELMDTRAQVLAASWDLHRFFHDCKD
VHQRILEKQNSMSDELGRDAVSVVAAWQRLLGACDGRRARLADTGDLFRFLCMVRDLLLW
MEDVVRQMNTSEKPRDVSGVELLMNNHQSLKAEVDAREDNLSSCVALGKELLARGHYASG
EIKEKLLALTTQRSAMMARWDERWEHLQLILEVYQFARDAAVAEHWLVAQEPYLLSQELG
HAIDEVEQLIKKHEAFEKSAAAQEERFAALERLTTFELKEMRAREEEQERQRQQEEMERL
AALQPPPSHEPSQDRWVAVPLRPFSNATLVGASTTSARQCVISGAPTDEDAQFEGLLLRK
HEWESTTKKASNRSWEKVYVVIRGAVLAAYKDQKHYKQEPESHYRNEPPIDLRTATAEVA
ADYTKKKHVFRLNSEGDQALRSALCSEEMGQWLQKVQAAIGEAEGSAGPSRAQTLPAERK
DEPKKRSFFTLKKK
Download sequence
Identical sequences B7Q5G8
XP_002411761.1.51680 ISCW021585-PA 6945.ISCW021585-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]