SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 70448.Q013F4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70448.Q013F4
Domain Number 1 Region: 119-214
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 5.23e-24
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.003
Further Details:      
 
Domain Number 2 Region: 217-270
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 7.85e-16
Family Head domain of nucleotide exchange factor GrpE 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 70448.Q013F4
Sequence length 272
Comment (Ostreococcus tauri)
Sequence
MARGTMTWARTTLARGTGAGATVAVRGRGRAHARSTRGRGPRARVAPVARSSEEEGETAE
AVDANDEDEDIVDVEETIESEAHGEESELSKLLGQLDVVVGDNAEAREILALLKTEMGDA
NAKMVGMEDQVGAMKDQYLRLNADFDNFRKRTAKEKADAANTAKGAFVKAMLPVLDNFDL
AEKNIKGNNEGEEKILTGYQNIVKQMYEIFESQGLVTVPGVGEKFDPMDHEAIMREETDE
VEEETIIEEFRKGYKIGDSLIRPSMVKVSTKP
Download sequence
Identical sequences Q013F4
XP_003080808.1.19543 70448.Q013F4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]