SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 70448.Q01AB1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70448.Q01AB1
Domain Number 1 Region: 222-338,370-428
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-33
Family Calponin-homology domain, CH-domain 0.00087
Further Details:      
 
Domain Number 2 Region: 657-725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000141
Family Motor proteins 0.026
Further Details:      
 
Weak hits

Sequence:  70448.Q01AB1
Domain Number - Region: 817-880
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000212
Family Motor proteins 0.057
Further Details:      
 
Domain Number - Region: 729-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00069
Family Motor proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 70448.Q01AB1
Sequence length 1149
Comment (Ostreococcus tauri)
Sequence
MGEDSPSANRGECASAREVRQTVRNKLTSLYSYDDELGRVLKKTFRHVDNARFRLNRGQT
FLDNVALKADFTRALSCFSPFWLQLGVDVVIGGGITWKSRGDLREVQEECIAALCRDRDL
EVEFGTGATPGAPPFAHGYEEALCRNILKRVLLLIFMLDRAATSGLPPNTPLLMRPHAAL
KQSEDVLQAALQGSMYGEGDLIRNLRQCSYRLNYKQNPIREYDFRCANLAVDLRDGVRLC
RLMEVLNADILFMSFDDKNKEWKRGLLNEVHFPCASRAQKVQNVEVALRAIKDQQVGLPG
TWSHIKAEDIVDGHLEHTMGLLWALMMHYAAPGLLLPKALDAEITRLGGKVPDVKRIERL
SAARRGDSVIEAPQCAMEARLYAWARAACATQKVELSNLGSGFADGRALCALVRAYAPSM
IPKRRISNVPLKLGNPNAEVAKNARLIAKDNFAVVCKAIQALGGVPNPTFDIRFSSEEDE
GSPDPRAVSGYLLFFSARLLLLRQQEVACVRIQRWWRWNRPHRPTFSQIVRKWTAAATII
ISHVRRVQGARAVEARRKAIVTVQXXXXXXXDVRQEYLDTKWATEKAQKMRKGCVQRRQF
LKEKRAAGIIQGWYKMICARQTLLNKICAATIIQARWRGFTKRTEARRLGEAREQLRHNA
AVKLQAAIRKCLVRKQFVRLRWAVVLTQARTRGKSARKTFVKAKKAVVKIQQNVRRFLTF
NAYNQRSRMIKEEKRKAAATTIQRHWRGYITRHRIDKERYKIWFVTLMQASVRGWQTRRR
VAQTRKEQAVKLRIQKMRLAKKTSVEVAIQQPRVATRRSEQLRAAMRYNAAETIQRYARG
TRIRSILGRQNAAATTIQAAWRCYAARADFVIMKVAASKIQEAFRSLILDRKRRDKIERS
VVILQAYVRGYLTRKRAVHKLEWHRKRITIASRVEPDDPVYNRAKKSVAMIMAPHSGKEC
IRGCKFFIQHWNNRTCRNALASSDALHVLMRNIHALKHSGSADASLTAAYAEHVPLLNAA
YELFQLVAGEKRYSHAVRKYPEILFLDHVRLFQDDPKMLASAIGVMDALFDNVGSKISVA
SENDSRLDRAEEILAANRATLRTTVSFYAKSGLTQNEAKAREALVLIDRCLSSLNRLRRH
ARAKLNIAA
Download sequence
Identical sequences XP_003079008.1.19543 70448.Q01AB1 jgi|Ostta4|32544|0400010490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]