SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 70448.Q01C34 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70448.Q01C34
Domain Number 1 Region: 27-145
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.86e-23
Family Calponin-homology domain, CH-domain 0.00033
Further Details:      
 
Domain Number 2 Region: 556-670
Classification Level Classification E-value
Superfamily YjgF-like 0.000000000000123
Family YjgF/L-PSP 0.0034
Further Details:      
 
Weak hits

Sequence:  70448.Q01C34
Domain Number - Region: 282-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000299
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 490-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0537
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 70448.Q01C34
Sequence length 673
Comment (Ostreococcus tauri)
Sequence
MTTPTPRARSTGATRRGRTTSTPTPSAIGRLELLGWLNRELTCDLASLRDCADCVAYCQL
VDALHPGAVILRALDFNAVTEGDKQRNARVLERGMRACGMEATVDYDALALGKFTEHNNL
LRWFYAYVAKNGAEALERYDAYAARVKAQRHKARDGGEKSEATVSRERCGRADDESEEDD
EGPRSGEVRIRAEVATGNNDISDSEDGEGGRAAARRENPGTLFDDVLNADNQNTTKQASQ
TNRKRRQAGRPSRYTIDEEDDDQEYDIIPVATQEYPDEIACSCGLCGRTFKTVRGRNVHA
SRCAGVRVENAPASAFVNASSGEHVCDKCGKMFPTFGGLKLHRVRWCKGMVSDNGADIVS
SKTLVSSGSLREMETTKRARRCLLRQSEDCDHANTSFKTFNALQEHMEQCHGVPRVMEPM
REVELDRSCRYCQECPTGEYRCKSFRQLCDHYKKEHNIVLLAVPGGANDVEVNGVSHEHA
QVEMLNGHLDCTECDFRGKNHKGLKVHMRLVHNLQVKSIEPPITRPSKRLPLEASARAQM
RGGDASAEIQRINPHEYGFSPIVTFGRHVTLCGVTASDEVEPTTTGQMRQAMVNLVELLV
QAGTDAMHLLSVHVYITDIREQFNVSKVWDKFFSDCGIDQKDRPVRYITQTFASKDAMLR
VELGAQAVLPTGH
Download sequence
Identical sequences jgi|Ostta4|31915|0300010469 XP_003078379.1.19543 70448.Q01C34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]