SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.D2A5S1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.D2A5S1
Domain Number 1 Region: 14-58
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000394
Family Calponin-homology domain, CH-domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.D2A5S1
Sequence length 198
Comment (Tribolium castaneum)
Sequence
MSSVLLEARPFRPFKSSEEYLVAMKEDLAEWLQTMYPSLEINVDNFMEKLETGVVLCEPT
RISNKQQNVVVKVAFAFAAIATRGCLPSRRHFPAKVDRVACGHQLIAKLRFHVDLDSRAR
CEIDDNDGMASLCMQIRALTPLTLTAKGHLDPKFPSFRLAFGRKETGLSYPVTCCIFIDA
IAYAKHVFFFVKSLARWE
Download sequence
Identical sequences TC015121 7070.D2A5S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]