SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_001815753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_001815753
Domain Number 1 Region: 174-221
Classification Level Classification E-value
Superfamily Tetraspanin 0.000000000183
Family Tetraspanin 0.017
Further Details:      
 
Weak hits

Sequence:  7070.XP_001815753
Domain Number - Region: 111-166
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0275
Family P40 nucleoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_001815753
Sequence length 259
Comment (Tribolium castaneum)
Sequence
MPHFRHVDTIFLKITMKKLKRSAPKIPDSDSLTSFFIPWHKNRAPPIYPNAQTGRIINTT
EFLLFFAAILLLILSLGLVGVSVWSLVSKSRYIFVDYSIELAYFALPVSLLCLLCFWIVL
SVHNDENSYKYLSLVLILLTFSTVLLVIGVYIGFTHKLHLNSSQIDSSPVLVEFRETMKG
SMNKTGIWDDVQRKLGCCGVDNYTDWLAVMQRIPESCCRRKVSLGKSPTKVDLLIENLNE
VAQPVAVILHAKSQEHTRQ
Download sequence
Identical sequences 7070.XP_001815753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]