SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_967040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_967040
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-41
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_967040
Sequence length 169
Comment (Tribolium castaneum)
Sequence
MSKRNKELEGEVLTWIFQVLGEPLPKGEFEDILRDGVVLCNLMNKLAPGSVKKIQAKGTN
FQLMENIQRFQQAAKNYGLPQEEIFQTADLFERRNISQVALSLFALGRITQKHPEWTGPT
LGPKMAEKNERTFTEEQLRASEGQVNLQMGYNKGASQAGHGGFGNTRHM
Download sequence
Identical sequences D6WAC2
7070.XP_967040 TC000431 XP_967040.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]