SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_973109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_973109
Domain Number 1 Region: 2075-2545
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.64e-144
Family Pyridoxal-dependent decarboxylase 0.000000000135
Further Details:      
 
Weak hits

Sequence:  7070.XP_973109
Domain Number - Region: 1562-1687
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00129
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 
Domain Number - Region: 431-520
Classification Level Classification E-value
Superfamily PapD-like 0.0602
Family MSP-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_973109
Sequence length 2575
Comment (Tribolium castaneum)
Sequence
MSVEIFQEPSSSSSLNSKSLRSIDIEFDLDSLPTTLEVNCVRITPPCMHFDNAYEGKRYK
YKMVIQNCGKHLAFVRLCEPNSKTFEFKSFPRGLHLSPGMKIVRTVKYTYTAALGVKRGF
ATIWVQGVRNTQVGTPSRTLSCAILTIEPQLLDFGRIDAVNHATSRSFFIINSGYRDTQF
AIDLGRNPLELTVEPMKGTVAAKTSVEISVEVVGSREGEFMEEFWVKANPPQRVVISGTF
ISPKLLVRKFINSLDFTLVDFPPTYYGSSSTQPLLIKNFSSSHSMFCVMAEIKGTTMTLD
EARKIDDNYLNFHITPIDGRLAALRGAVLQITFAPVVTRKREKNYSAGFLKVIRMDCRDV
GHNEIRTKDNSTSSPTLVDSSVALTTNDILIDDANGSYFSLTCEDELASETFSFEHSIGV
CIHGEKERAGVTLTPTFITLNELTLQKEYHRVVLVQNQSSHLPVRVKYNKVLSIDVRPNQ
FDLAPSDSLEVLVIIRALKLGQVTKKVTFDLLSKVSPDDRHVMRKVGVAILRIYVETKNV
AKKEALGQCVECGPCRDLANKLAPDFPYRLSPEEMAVKLENEKFYIDYIRSLCKPPPPEN
EDLRDYALTNYKLLLRQNTKCRDAAPRPKKIISYTPFIPLLPRLLYNIKITPKSIRLRKV
AAFTTITDYFQIQNLNTFPIRFSKTTPGTLSKVARRRKSPSRSVRVASAGTTSTSTCWST
TTLRVEPHHIEFHEYDGHYKFFKLMNGLNAYTSFEWEVPEGSFKIYPAYGGIKAESYILC
MMAYTPDLTEESFSECVLTSESGQKRILQVSRKKRKYDVAFDTYEIDVGLISLNIPVRRK
LIMKNLKNFQTLFSIPGGVPVPGVKIEPQEGILDGLDSQVFIITVHINAVVEFSTEIVFL
VGEREEVAIAFKGSVDFPKFSFKPDIMYFRKIAPFGFDTLAFVVRNLSKTTNYVTFPCDE
FPEFTVTDNEDEHFPHIDKIVLQPSQGKVFYLHFHPYYISTYSLFLPFKINDILGPVNIN
SNATASTNYFLRELTTKYENNYSINILTRYPKALPLVRLTASAIEKTLEFSSLNINFVYF
DEDHYNNVTSTDFEITNTSDDVAAVCIRLDDLDYPFSLQPKGNPNVEYYGISYKIVLEPG
EKAAFSAQFSPSDLGEYVVKLPLFLRHYFDDKIFNYLTLRGVYDTPTITPSLACIDFEPV
PVKLASEFRLKLHMNNHFENCEVISDTEVIGLHAMFEKGRRPEKGESVLPVSLVYECTKD
SCFNSKLAFYCTCNARCEVTVTGVTENNLLTTHAYSHMLKESGSTDGSSNFLYSHKSSTP
YLRPEYIDMLTNKNTTPYPLFPSDDDKSDYAEYMRKLRKTLENWLFTQVFYSKCYYKIPE
GFSDFCKADPDRKKVRFGGIKKSKTVELPLLQLIANVCGQGIKQRLSAKFPADSTDMQWL
VYTYKTNSNILHYLRGFPVHLPHVSAKLLLNYDQYVQYERTKHPERAIMDERIFNRGSKQ
CWIDLILQIIKTFFLFRTVELPFNDSESSESEGRFKEKQSLTQFSRQSTEDKGEYVLDVG
IYGVHEKELIFWLQKCYDEESENLWKEPPPEPKELIFLDVDLRDGLILGAVTARYCPYVK
PLISDMYPRPYNPEEIHHNSCILVKAWKKLKLSYVISPLTLQHCGMVEMLLLANYLYAVL
PNYYPKEVITIQAPLTQGGSASIEIENAGGNEIVYHVVFFENPNHLFSANAEVIRLQPGE
KKTVKVRYHAKSVLNTTTTLLFSGETPGNKYGKSVAVTVVGEADVSSVCMEIPLTVNLYQ
PCKVTLNTQSPFKIQTDYALLFGYQPVSKEKNVLFPWEDIKQLKTVKEFVIPDEMCLFDE
EGKCTASPLICCHQIGPRDLWFYFTNPEVGDWGIKMTLTGKIHGGCFENLSLNLPDNYEH
LVCRCKPKPSVHTNCPLVMYLQIPMINTPLWNARKKMLLNYVDGEELKFWSKRIFTPTGT
RIMTLILNSETHQMRQVIEETVQYRVILDKPNCFITLRDVVFDDVTSEEFYRLPIHPVKN
LKDVGTCRMRLQSEDKIETRFYKITFNFPEESVTMDSQQFREFGKAAVDYIADYLETVEE
RPVVAGVAPGYLEKLIPEEPPQAGEKWQEVLQDVDRIIMPGITHWTSPHFHAFFPTASSF
PSIVGEMLSAGFGCVGLSWVASPAYTELEVVMMNWLGKLLGLPEEFLNCSEGPGGGVIQG
SASETTFVALLAAKEKTVRDIQKLHPELSEAEIKGKLVAYSSNQSNSSVEKSGLLGSMPM
RLLPVDEKGQLRGDALEEAIRKDKEQGLIPCYVVANLGTTPTCAFDKLEELGPVCQRENV
WLHIDAAYAGSAFACPEYRYLMKGVEYADSFNFNPHKWMLVNFDCSAMWVRDARHLVEAF
NVERIYLKDQHKGLAPEYRHWQISLGRRFRALKLWFVLRIYGVDGIQKHIRHQISLAQRF
EELVRGDQRFEVCSSSMGLVCFKLKGDDALTVKLLERVQQRKKIYVIAGHFGESHVIRFA
VCSRLTEKRHVDYAWNEFASQADEILGCKVERKSDISIEISNARCQKINDIEKSK
Download sequence
Identical sequences 7070.XP_973109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]