SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL006922-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL006922-PA
Domain Number 1 Region: 17-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-45
Family Calponin-homology domain, CH-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL006922-PA
Sequence length 188
Comment (Aedes aegypti)
Sequence
MSVNRAPKSGFAAEAQRKINSKYSEELAAECLEWIKEVTGEPINTSGEMDNFYEVLKDGV
LLCNLANAIEAGTVKKINTSKMAFKCMENISAFLEGAKKFGVPPQETFQTVDLWERQNLN
SVVICLQSLGRKAGKYGKPSIGPKEADKNERQFSDEQMRAGQTVISLQYGSNKGATQSGI
NFGNTRHM
Download sequence
Identical sequences A0A023EJ28 Q1HR19
7159.AAEL006922-PA AAEL006922-PA AAEL006922-PB XP_001652323.1.48696 XP_019563763.1.17567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]