SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL007342-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7159.AAEL007342-PA
Domain Number - Region: 7-79
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 
Domain Number - Region: 83-143
Classification Level Classification E-value
Superfamily YfgJ-like 0.0706
Family YfgJ-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL007342-PA
Sequence length 148
Comment (Aedes aegypti)
Sequence
MDNKGQPYPAHAPGFIPVPNQPPPQHPTGYPHPPPQQSYAHPPPPPPYDANANMIPPTGA
HPQTTYVHTIVAAPQVGPDPASITCPSCQKHIVTRLDYETSTKTHIFAGLLCLFICWPCF
WIPYVIDSCKNANHYCPNCGAYIGTYRG
Download sequence
Identical sequences Q172M1
AAEL007342-PA 7159.AAEL007342-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]