SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL010263-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL010263-PA
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000412
Family Extracellular domain of cell surface receptors 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL010263-PA
Sequence length 134
Comment (Aedes aegypti)
Sequence
MPIYSLHSADALKCYRCNSYDKIDCLDESDSNNDTRNSTKLRPFLHECEPDPTGQNREPF
CRKISVTIMKPKHHRVIRDCGYERSHLDCYVADNDGHLETVCQCWSDQCNGAERLTSGVA
LGLAVMVAILRLVV
Download sequence
Identical sequences Q16TE3
7159.AAEL010263-PA AAEL010263-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]