SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL012619-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL012619-PA
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily L domain-like 5.33e-36
Family Leucine rich effector protein YopM 0.025
Further Details:      
 
Domain Number 2 Region: 543-583
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000128
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL012619-PA
Sequence length 583
Comment (Aedes aegypti)
Sequence
DLSRNRFCELPDDITSLAFLERLLVFHNTIRSIPDTIRGLHSLTYLDLRNNQLSVLPREI
CFLPLQVLLVSNNRLVTLPDELGRMEELTELDAACNQITHLPPRMGDLRNLRSLTLRNNQ
LVYLPRDLTCLQLVFLDISCNKIATLPVELRLMGTLVDLELSNNPLTSPPASLCVRGLVH
VFKYLETAAAKEEKSKCGTDGHATLRRSALTSKNSSGSLLDGTRNRRAHVDSGYSTSDGG
FEGKRWSQDDPHDYGTCSPKWSPIPMHTGFAGKPPPASSSTAQHSHSGGSGYSNLLSSSG
ANGGLSGLLGSDFHGAAGTLEEEFRKGVALLDQQERKKLMKADEKMRSLGNIQTYREYKE
ALRQQRSQNDIYRPKEQQAQTPDSGGSAGDSPLSNFSPYNNSPLSPHHTNIHKLNQINAN
SNHTNNNNNNGFNPAGPGTSPLLSPNRNIVAPFEESNSSTSSTPNKRPVQKVIPSRNITS
SYQSTVNGGGLPPPNGSQKPLTATVGYVNNAKPGQKTNKTVSWNRDVPTDKLSFTMRREF
DKQKEETELIEQLRQIIETRLKMTLPEDIAPALTDGVVLCHLA
Download sequence
Identical sequences Q16LL2
AAEL012619-PA 7159.AAEL012619-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]