SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL013124-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL013124-PA
Domain Number 1 Region: 54-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.68e-35
Family G proteins 0.0000163
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.79e-22
Family Transducin (alpha subunit), insertion domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL013124-PA
Sequence length 262
Comment (Aedes aegypti)
Sequence
MEYVQRVRTVWADSAVKMCFKRSNEFQLIDSAKYFLDRIEKISMPGYIPSNSDILNCRKR
TTGIQEVSFHIKLPKSLGGGSQEFRMFDVGGQRSHRTKWMQVFEGIEAVLFMIACGSFDQ
TLREDPKQNRLVEAFELFRGVWHNRFLAETGLIVFLNKQDILEQKILSGKSIKDYFPEYE
EYVKATDSDNLCDELTRTRCFIKSKLIDITNETPRRTSLLAQRKRTCYYHFTVATDTNNV
RMVFNDVHNIILARNLHNVGIL
Download sequence
Identical sequences Q16K44
7159.AAEL013124-PA AAEL013124-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]