SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL013242-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL013242-PA
Domain Number 1 Region: 696-971
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-40
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  7159.AAEL013242-PA
Domain Number - Region: 1473-1551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00393
Family Motor proteins 0.031
Further Details:      
 
Domain Number - Region: 1629-1697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00611
Family Motor proteins 0.025
Further Details:      
 
Domain Number - Region: 1702-1850
Classification Level Classification E-value
Superfamily ARM repeat 0.0472
Family Plakophilin 1 helical region 0.066
Further Details:      
 
Domain Number - Region: 971-1047
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.085
Family Motor proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL013242-PA
Sequence length 1934
Comment (Aedes aegypti)
Sequence
MSAFEVKVTPTRPTAQPKRRTESREPTLVMLGPFTPKATVIFDGVPVGKSARRELIVKNP
YDEEIKVLVTKIPRTEFNLGLQWTSQDIPAGEERQMDLVWNPLKMFANKEVLQMSDSFGN
KKDIALILKSVELRKAPPVKKPVFKQVPLVPKKLKLKSPSPPKAVLKRNLLVKKRESPAR
KTFASSPPVARQAAPRMNVLQPSNASNLFNSSEFNFSNISECISVKTKTNKENVSPVTPE
NASKLFSNLKFTPSNSQSNLSYLASLPTPVNCYNIDDIRLDKPNLLRRRLSISPEINLDD
EELTPRIQTNQSVLAMKETPKSCYTSSNQMLSARNQQLSLTPTNATRNEFDPNCFSTVTK
QFQSGKTYLMIDETVEKDSNKQLDYSHDLELTELQLKCSPTPSDDNIVQHLTMEIKQQQQ
GSMPNLNAAVAGEYEDDGEARMMFKAHEIRAQSSRFNLHEISRISDEMKPPGTKRHLDSS
MASVDLADEPLAAVVISPPKKSKLMQTTPSMSSMQRSSNRSMSTSTAAKPCFQVPKSTAP
RSLSLRRVPVSNGSSKKLPLEEKRIFLYDSELHLKTLINPDPFAATTTCDPFLTTTMYLD
ERAFEKYERQLKKWLNALVTIPADLDTEPNKPLDVGKLFDEVKGKELTLAPTKELISSNY
YKSRLNQLRSAGISLYLSEKVAEPLRKVRSAIEKKTMTLRTDRDLHLDLVLQRSVLELLL
CFNPLWLRLGLEVTFGEQIDLQSNRDVIGLSTFVINRLFRDRYMEMKNSKAYSLSSSYSE
HMKKFTFRMFLFLLFFLDTAKNQRLIKHNPCLFVKNAPYKETREILIRFSSHLIAGIGDI
TKHLKRFGYVLTHKQTYLDEFDYAFENLAVDLRDGIRLTRVMEIILLREDLTQNLRVPSI
SRLQKVHNVNLALKALEDAEYQITGDITAKDICDGHREKTLSLMWQIVYKFRAPKFNAAA
NVIRDWWKRNWLKVVISRRIEEKRRRRREQAAVTIQAGYRAYRTRQNFRRMRAEKLKAVI
ILQKYSRRYLTQKHTAHRYASILRIQRWWRSVQQTRADREHFLLQRKSATVLQTTFRRRV
LARKIMAASVQRREFLQLKEACVKVQLRWRECLLARKERRSYLEMRKSAILIQQTVRGYF
MMKEAVATYQKERDSIILVQRIFKAKLEMRRVRSEYLQVKLAAVCVQRRFRALVAMRKQR
SDYLQLRLATLVIQQRLRAQNVMKLERKRFETLKGAAIVVQQQFRAQVAMREARDRFQLM
RSSCIQIQRRLRATILMRKQRIEFLKLQYHVMVVQRQFRANILARNQRKQYLKVRTSVIQ
VQRKWRATIYARQMQLRYQEQRNTAIKIQRYWRAIQLKRKMRENYLEKRIAAIKIQKYFR
GHLLTKQIREEFVTLRSATIKLQQRYRANKSMQMQRMDYERLVQASVVIQRRYRAKREAM
RLARTEYLQTRSAVVLIQQKYRAKREMERACGRYLNVRSATILIQQYFRGYLEMKRQKES
FVRLRSATLCLQTRFRAMKQMKLQRSLYLEERSSAIVIQRYFRGYLATKQQRSSFLQKKQ
ACVVLQSRYRARLAMLKEKCEYDHLRSATITIQRKWRATMAMTRQRSSYLRILQATQTIQ
IRYRAYRLRLLDQLNYRVYRIVTLRLQARCRGYLARQAFLKKLTPEFRERRLREQAAKRI
QACWRGHQYRKKHQTVTMRDIALRMIASRREAARDPSKRVSNILRSCMKFIQSRFAVHEA
IKVLLRIEQISRTVPYLLQSDAVFLAAFCYVTMAQAIRSELDKQLIEICARIILNLARFE
GTKKDAFQENGLVTVSQMLLRWCDKECAIFNTLCTLLWVLSHDTHKRNAIRRYMISREAI
FMLRETKKLVQRKENMRKNVKKPVGCLAPPDPTLMRMEPALEPDYGVIRSKPYVFYSSVF
AFDTVLNVLDVDIS
Download sequence
Identical sequences Q16JR7
7159.AAEL013242-PA AAEL013242-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]