SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP003644-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP003644-PA
Domain Number 1 Region: 85-199
Classification Level Classification E-value
Superfamily Translational machinery components 9.16e-37
Family Ribosomal protein L18 and S11 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP003644-PA
Sequence length 199
Comment (Anopheles gambiae)
Sequence
MSLLKQLNLLSGLVRRTLVGSVRPLHQTATLRKVEDRKAMLASLPSKDEGTVGERSIDID
SMIDKKTSIFPDANTPTSLINGVPFNEIPICHIRVSPNNTIISITDAKGVPQFIRSCGIE
GFKNTRKGTNIAAQATAISISTRAIERGYKTVRVTVRGLGPGRMSAIKGLEMAGLNIVSI
TDTTPVSWNPPRPRKQRKL
Download sequence
Identical sequences A0A182I996 A0A182U332 A0A182WVL7 Q7QAL0
AGAP003644-PA|hypothetical XP_313411.2.40869 AGAP003644-PA 7165.AGAP003644-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]