SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP003703-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP003703-PA
Domain Number 1 Region: 712-996
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.79e-46
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  7165.AGAP003703-PA
Domain Number - Region: 1640-1734
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000372
Family Motor proteins 0.029
Further Details:      
 
Domain Number - Region: 961-1096
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0319
Family Extended AAA-ATPase domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP003703-PA
Sequence length 1968
Comment (Anopheles gambiae)
Sequence
TSRQVSCTPPRAVAKPRTNESREPTLVLLGPFTPKATVVFEGVPVGKSARRLLIVRNTNK
TLVQVNLTRVPDPGCGLWFEWTTADVEAGAEKTLEVVWNPQQLLVGKDVLVLTDSIGNRK
DVQFILKTVEPKSAASRKPVAKSFAVPKKLKLKSPSPPKVKLKRNVLPKKTKTSPGKPGW
SVPTITVGSRMGTIASKVTTAMYGPGAGDGSFDMMDEYGAPSSGTMRTEGDKTTTDKENV
NPTSPLVIGARLDAKQFLSPLSDRNTRFDPSCFSTVTKPLPVDKTFLKPFIASPTMVDSS
LVQQQSDENLQRHLTFSLEHEQGDTEEHELETNQKDEMPVHEEHPENATDKTHTVAHDSN
PHLTSIAEENVPELGITFERRHDRRNGSVSDDAELLASLHTQQTFIVSAEQSSRSASVEN
IVRNVTVTIKDSVSRSSLPNLLDKSSSSNSSSTNKSHHLEEDEGDKIFREHEIRAQSSRF
NLHEVGRFSDEMVVPSTGCKRSIESVGDGKELKLEPFELTISPPKRRCRLTSSSSAIIAQ
ALQSVTKTETQMSISSTFRKPIGYNTSRSLSLKRTAVPCSLPPKSEEKRVFLYDSDRHLK
TLINPDPFAATTTCNPFLTVTMYLDERAFEQYERQMKKWLNALVTIPADLDTEPNKPLDV
GKLFDEVKSKELTLAPTKELISSKYYKTRLNHLRSAGIALYTSEEIAMPLRKVAAQIEKQ
LLSLRTDRNLHLDLVLQRSILELLLCFNPLWLRLGLEVVFGEQIELQSNRDIVGLSTFII
HRLFRDRYLEARNSKAYNLSRAYAEHMRKFTLRMVLFLLLFLDTAKRRKLIKHNPCLFVR
NAPHKETKEILIRFASQLVSGIGDITKHMKRVGYVLSHKQSFLDEYNYAFENLAVDLRDG
VRLTRVMEIILLRDDLSASLRVPPISRLQKIHNINLALVALEQADYKIAGNVTAKDICDG
HREQTMSLLWQIVYKFRAPKFNAAAIVLQRWWRMNWLKVTISRRIEEKRALRREAAARTI
QAAVRGYCVRVWYEAHRRQKLRAIVTIQRFSRRYLAQKLAARRFSAIVRIQQWWRTVRQM
RQARERFLLCRKSAIVLQTSYRRYALGRKLLAAATLIGQIRAEAKHRHLQATIIQRSIKS
YVIHRRLHATVNGMVAFIRRKRLQNRSAAKIQAYQRMRIVRKEYLRSRSAAICIQRRWRE
CMEARQLRNRFLLMRASAIRLQQQYRGWRQMRQDRHTYANARNLIVQVQRRWRGTLAMRK
ERANYRTLRRVTINVQRRFRARQAMQSEVERYRTLCKATVTLQQRFRANKAMMEQRQQYN
SLRVATLCVQRRFRAQLSMRAARASYAKVRCAILTIQSQYRATLAMRHARDRFVTLRRCT
ITVQARFRAILAGRAAKQRYESIRKATLHIQRKWRATLEMRQVRSHYRRQCNAALTLQRS
WRGVLLQRKFRHDYLLYRGAATVLQRRYRALVQGRMVRREMQHCRWAAVTIQRRLRATLQ
MNRDRKAFLQLRQSVLVVQRRFRANRACRVQRVQYAALKRSAITISHRWAATLHMRQQRS
DFLRLKSATVVMQRRYRAQRAKQQAVQQYERMRAAIVLLQRKYRAQRAMEKCRGRFLNLK
SASIVVQEFYRGYRNMRHDRAAFIRLRESVLAIQRRFRGKLLTRQTSLRFEQIRRTVRGL
QTYGRGVLARRAFLALLTPEYLERKRQQKAALRIQAWWRGAYHRKRYQTMQMRKIAQQMV
ASRMAARRDPTIRLSNVSRLCLRFLKTRFSSSEAIGILKRLERMSRLVPHLLMEDAVFLS
VFCYNMMAQAIRSEVDKILIEICARIILNLARFRGTKEQAFQEDGLVTVSQMLLRWCDKD
CGIFSTLCTLLWVLAHDNKKKNAIRRYMISKDAIYMLRETKKLVQRKEKMRKNVQRPVGC
LVAPNPQLMRTVPSLEPDFGVNRSKPYVFYSSVFGFERVLQMLEVDLS
Download sequence
Identical sequences AGAP003703-PA 7165.AGAP003703-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]