SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP004335-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP004335-PA
Domain Number 1 Region: 26-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-73
Family Calponin-homology domain, CH-domain 0.0000994
Further Details:      
 
Domain Number 2 Region: 1117-1229
Classification Level Classification E-value
Superfamily E set domains 3.07e-37
Family Filamin repeat (rod domain) 0.0000362
Further Details:      
 
Domain Number 3 Region: 932-1035
Classification Level Classification E-value
Superfamily E set domains 3.07e-29
Family Filamin repeat (rod domain) 0.0000421
Further Details:      
 
Domain Number 4 Region: 2004-2097
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.0000225
Further Details:      
 
Domain Number 5 Region: 1627-1720
Classification Level Classification E-value
Superfamily E set domains 2.67e-26
Family Filamin repeat (rod domain) 0.0000431
Further Details:      
 
Domain Number 6 Region: 280-380
Classification Level Classification E-value
Superfamily E set domains 1.67e-25
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 7 Region: 1811-1902
Classification Level Classification E-value
Superfamily E set domains 2.2e-25
Family Filamin repeat (rod domain) 0.000079
Further Details:      
 
Domain Number 8 Region: 461-579
Classification Level Classification E-value
Superfamily E set domains 6.07e-25
Family Filamin repeat (rod domain) 0.00081
Further Details:      
 
Domain Number 9 Region: 383-495
Classification Level Classification E-value
Superfamily E set domains 1.21e-24
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 10 Region: 1023-1139
Classification Level Classification E-value
Superfamily E set domains 3.4e-24
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 11 Region: 751-864
Classification Level Classification E-value
Superfamily E set domains 9.55e-24
Family Filamin repeat (rod domain) 0.00072
Further Details:      
 
Domain Number 12 Region: 1219-1327
Classification Level Classification E-value
Superfamily E set domains 1.27e-23
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 13 Region: 582-671
Classification Level Classification E-value
Superfamily E set domains 2.8e-22
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 14 Region: 2322-2412
Classification Level Classification E-value
Superfamily E set domains 3.14e-22
Family Filamin repeat (rod domain) 0.0000462
Further Details:      
 
Domain Number 15 Region: 2193-2283
Classification Level Classification E-value
Superfamily E set domains 1.87e-21
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 16 Region: 1307-1426
Classification Level Classification E-value
Superfamily E set domains 6.07e-20
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 17 Region: 1924-2018
Classification Level Classification E-value
Superfamily E set domains 1.6e-19
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 18 Region: 2111-2189
Classification Level Classification E-value
Superfamily E set domains 2.14e-19
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 19 Region: 674-771
Classification Level Classification E-value
Superfamily E set domains 1.05e-18
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 20 Region: 1547-1640
Classification Level Classification E-value
Superfamily E set domains 4.8e-18
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 21 Region: 1708-1807
Classification Level Classification E-value
Superfamily E set domains 1.8e-16
Family Filamin repeat (rod domain) 0.0000711
Further Details:      
 
Domain Number 22 Region: 881-953
Classification Level Classification E-value
Superfamily E set domains 0.000000000000454
Family Filamin repeat (rod domain) 0.0047
Further Details:      
 
Domain Number 23 Region: 1415-1517
Classification Level Classification E-value
Superfamily E set domains 0.000000000000587
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP004335-PA
Sequence length 2412
Comment (Anopheles gambiae)
Sequence
QGAPQYYQELQQQQQPRDYDDPDADEEAEMEAERDLAEDAQWKRIQQNTFTRWANEHLKI
INQTIANLESDLSDGLRLIALIEVLSQKRMSKHNKRPTFRSQKLENVSVALKFLEVEGIK
IVNIDSSDIVDCKLKLIMGLIWTLILHYSISLPMWEGDENGDNLANGNGASPKQRLMNWI
HRLVPDLPINNFTSDWTNGKAVGALVDAVAPGLCPDWPMWDPKDAVQNAAEAMGLADDWL
NVRQLIRPEEMVNPNIDEQSMMTYLSQYPNAKLKPGAPLRPRTNHSRVRAYGPGIEPTGP
TVGAPANFTVETFSAGKGNVDVAVHNPNGNPEKVDCRFNNDKNLTYSVSYIPKLEGPHKV
YVKFNGRDIPKSPYEVQVESQAGDASKVTATGPGLLPDGVVVGKQTYFDITTKDAGKGTP
EVIILDPANHKTSVAAKLRQVGTDQWRCEYTAKQVGLHSVNVFFCGQQIRGSPYGVRVAP
VCDPRKVRASGRGLQPVGVRVNDDDVTFRIFTEGAGEGIPEVKIFGPGGVVPEHSIRKLD
ATTYEAQYIPLKEGRYKILVLYGSQEIPKSPFEVTVGPQKHTSIVAYGPGLKSGMVGQPA
CFVVETNGETGNLGFSIAGPSQAEIECHDNGDGSALVKYHPTAPGEYAVHILCDNEDIPK
SPHIAQVLPKADDFHPELVKVSGPGVEKNGGVIVGKPTEFTVDATRAGSAPLEVKINDVF
SNTIAHKIAQTESGMKKITYTAPSAEPVTVEVNYGGVAVPQSPFRVNVSTPLDASKVQFF
GPWLEPGVKPNAATHFNVDARAAGNGLLEVNLVHEESKQKVPVRIIDNNDNTYAVEVIPP
LPGTYSTNLLYGGLKVPMSPKVTVAPPVDVSKIKVDGLEPNLAVTITSPSGNRVKAHVIP
TAEGFLVNFTPTQLGEYLLSVSFGGTPITPQPFRLQCLVGSDSRKVQASGPGLVRGIINR
PAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEIGDYTINITFNDDH
IAGSPYQAIIVPEPNLNKIRVSGMGIQPHGVVMNAPTDFLVDMSKVGNDVDRSKLSCNIF
DPRGNEIPSKLVPSDSADDVFRIMYTPFEAGRHTIDLLYDNVPVPGSPFVVNVKSGCDPS
RCRAYGPGLESAMTDKMATFTVETRGAGAGGLSLAIEGPSEAKMSCTDNRDGSCDVEYMP
TEPGEYDVTIRYADKHIPGSPFRVVVNESTRPEKVKVYGPGIEHGQVYDGLPAQFFIDCS
GAGPGKIAVKLSSSEGKPIATQVQDKGDGVYGVTYVPPKEGSVITANVCFADQDVSCSPF
VMTVAPAPNDVPVKVYGDATTKKALPASLPAKFQIDAPKTKAKEDINVSIKGPDGKPLVP
KMEQEADGTYGVSFVPDECGPYNVSIKCGGKDVLGSPFLLQAIPTGEADKCKMVQAVPVN
QEYGKKNHFAVDAREAGTGAVTCKIVSHSEASDVDIDIIEKDGFFDIFYVLKDPGDYDLD
IKFGGQNIPNGTFTIKLSASTTTTSNSSATNGNGTTEHDNHLNGTTQSSSRFHVFKLDRL
NTPQTGGTVTAEVKMPSGEVDKPVIDDNHDGTVSIRYEPKEEGIHELAVKYNGEHVQGSP
FKFHVDSISSGYVTAYGPGLVHGVTGEPAQFIISTKGAGAGGLQMAVEGPSKADITYHDN
KDGTVSVSYLPTAPGEYKISVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTLPGV
ISDNDLRSLNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHTVSVKRLGKHIANSP
FKVNVCEREVGDAKKVIVTGNALKEGKTHQDNVFSIDTRNAGYGGLSLSIEGPSKAEIQC
TDKDDGTLNIAYKPTEPGYYIVNLKFADHHVTGSPFTVKVSGEGTNRQREKIQRQREAVP
ITEVGSQCKLTFKMPGITSFDLSATVTSPGGVSEDAEIQEIEDGLYAVHFIPKELGVHTV
SVKYKQIHIPGSPFQFTVGPLKDTGAHLVKAGGPGLEHGEQGVPAEFNVWTREAGGGTLA
ISVEGPSKAEIEFKDRKDGSCDVSYVVSEPGDYRIGLKFNDRHIPDSPFKVYISPAMGEA
HKLEVAQFPTGCVQADKPAQFMVRKNGAKGELDAKVVAPSNNEDDCFIQLIDQDQYSVRF
YPRENGIHAIHVKFNGVHIPGSPYRIKVGKDDVDPAAVHASGKGLGDVKTGEKTDLIIDT
CNAGAGTLAVTVDGPAKVAMDCTEVEEGYKVRYTPLLPGHYYMTIKYNQMHIVGSPFKIN
CTGESLAEAGGQETSSVIVETVAKVSKGGNRTGVILPIFKSDASKIQSKGMGLKKAYMGK
QNQFTINAGDAGNNILFVGIYGPKGPCDEVFIKHTGRNQYTVNYLVRERGDYILLVKWGD
DHIPGSPFKVEV
Download sequence
Identical sequences AGAP004335-PA 7165.AGAP004335-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]