SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP008402-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP008402-PA
Domain Number 1 Region: 17-79
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000267
Family Calponin-homology domain, CH-domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP008402-PA
Sequence length 124
Comment (Anopheles gambiae)
Sequence
MPSRRKSIQLSTQELIDVYQWVKQFNLSKDIKNINRDLTDGVLVAEILKHLYPKLVDLHN
YTKCYATRNKLDNWQTLNRKVFSRLNIYLDEEMMSDLACGSNGMLEVLLFELMAKYKWEN
KPSY
Download sequence
Identical sequences Q7Q4H5
AGAP008402-PA|hypothetical AGAP008402-PA XP_317050.4.40869 7165.AGAP008402-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]