SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP009399-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP009399-PA
Domain Number 1 Region: 3-29
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000262
Family Nuclear receptor ligand-binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP009399-PA
Sequence length 84
Comment (Anopheles gambiae)
Sequence
IANLCNIADHRLYKIVKWCKSLPLFKHISVRIRNHLRLLDERKKIASACVCFCTVSVSPL
CAARTIHCTKTLQFAVGCVSFREL
Download sequence
Identical sequences Q7PSF1
AGAP009399-PA 7165.AGAP009399-PA XP_310076.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]