SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP009554-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP009554-PA
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-27
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 3339-3495
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 2914-3065
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 3777-3927
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-17
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 5 Region: 11140-11291
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 6 Region: 6035-6184
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-16
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 7 Region: 3989-4144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000019
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 8 Region: 6254-6411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000504
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 9 Region: 5285-5438
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000155
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 10 Region: 10528-10689
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000023
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 4420-4544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000932
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 12 Region: 4638-4776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000103
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 4859-5013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000132
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 981-1134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 3128-3249
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000044
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 16 Region: 4988-5122
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000654
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 621-727
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 18 Region: 378-497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000353
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 19 Region: 4139-4258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000824
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 20 Region: 5661-5776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000102
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 21 Region: 9837-9953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000222
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 22 Region: 895-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000633
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 23 Region: 3566-3677
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000196
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 24 Region: 2490-2610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000216
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 25 Region: 1200-1345
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000299
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 26 Region: 5554-5661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000446
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 27 Region: 2405-2532
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000461
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 28 Region: 2701-2821
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000733
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 29 Region: 687-813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000101
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 30 Region: 1523-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000593
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 31 Region: 5182-5309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000596
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 32 Region: 4778-4870
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000045
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 33 Region: 1303-1452
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000468
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 34 Region: 2290-2400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000131
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 35 Region: 5410-5507
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000222
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 36 Region: 1956-2091
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000059
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 37 Region: 6670-6825
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000935
Family Spectrin repeat 0.0091
Further Details:      
 
Weak hits

Sequence:  7165.AGAP009554-PA
Domain Number - Region: 506-613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00011
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number - Region: 4548-4652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000122
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6849-6938
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000182
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 9381-9484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000849
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 7357-7469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0017
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5773-5882
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00368
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 7204-7323
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00412
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 6995-7103
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00576
Family Spectrin repeat 0.024
Further Details:      
 
Domain Number - Region: 1754-1880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00633
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 309-411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0108
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 10955-11049
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 10326-10459
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 10212-10347
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0611
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 5140-5196
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0647
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number - Region: 9938-10013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 6566-6661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0777
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 3464-3560
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0791
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP009554-PA
Sequence length 11410
Comment (Anopheles gambiae)
Sequence
MMKQGPKKTLLTWVNSALPKTTGLEVRDFGPSWRDGIAFLTLIDAIKTNVINIAEMKKYN
NRYRLDTAFNVAESELGIARLLDAEDVDVSSPDEKSIMTYVAQFLHKYPDVKNINSKSDS
ERELLELLDWLRRTVRYYDGMHGKYPNNYSMYESVNGEKLEKQNIYKKVKSINAAKMTPE
VQELNSLWTQLERHMQQWLWYLDSSLPDQFGAIGRWLSNGEKLLNDDDIPNNMNEETASL
ISKKLEAHKQFFASYYEVRETFNNVKLTPLAKKVPLGQLQNMEKRLLDIEPCARQRRIKL
KYLEHKCCLIAFLNLLENKINGVKYNNEETVKQSLDHLKNFVTRNQIMQEFEKALIDMRQ
VIEEYKIDGNITKKEMYNIDVFLHEIEDRWKNVSSRLICTETMLEDVLSHWQRWRTLVHE
IEMWLRQAHDALQGTEDERIEFFQNISVYKEKFDALTDTFNILKSTCDQDTAIALERKYA
QLGGHWEQVFQHTKQYLHVGDILQHRQKFKADAAQLNEWIQRTETALGRNNLRDAAEIRR
CETEIKQIACEIEAMEELFKSISRSFQALIKEYSRDEVDRMMMMMKKQKEALVRVRAQIP
IKLHLFHQLLTQQEALETGQREIAQWLDEAENLLISYSFTNDPQQTKNNLAKHKAFFNRT
LYYKSMLESKNNVFQNLLKLTDTDSSIDMSDAATKMKQLNDRFAYVINNANDWEYKLQEN
LRVWENFTESKQKVESFLRQAEAFQKSAIPVDKEADAESQLEFFNSADQTSINTLERHTE
DLLKYLPPAEQQILIAKVEDIQRQWSEVIQQIPLHLLKVEFRLNELTFNGCANDIEKELN
AEEQAFNCNENFEAILQRNLDYFKKNDLQRVEQVLGNMEKINYIYLEKSANDQALAPLYQ
RANDSWIAICKRIDIVRNILHKIPAQWDAYHAKFDEMNGWMDRVDESLRQIMVEKQTMEE
FEQEKATFQNICFEADAKREDMKWLVKTLDFLLSHTNEEQATIEQEKIEKLIARYKTLIP
TIETTMTKTEVFAKCYTYRREAQEICDLLDRIKSQARSVPPPESYKRVNEMIEEQQYSIK
ELDNQRAHIMKMLQRGKDLSKNPSAPQFIAGEIRRLETGWNDTYNEAAEKVRALKAIQKV
WGDYNEQKGQIVGLLNTAEMELRSVTPLQTDPKSVTQDLEMKRQLALNLKQASSKSLLQL
NDLCRDLGISLPPTTRQVIEKEVTDLGKRVDNTVDYVEQRVVYLEDYSDKWNEYKQRLDS
LKSWANNVYPKMVAAIKQPQISAEDRVLKAKQLEGVLGEKIRQLDVLNASAADLASKEGN
LSEMKRLKAEVVHLQGTFTELHRMVDSEKALVGEDFETWKSYNRDMDSLKEWVERAKLAP
ELEQIRPSTLPEARAYQGRLETFNEQCEGKMDELQNVIKSSQNIRYGVKPSEETDRYYMI
VSSIYENVQHLLNKTGKLVTNWALLDGDLEKLNHFIERAEVRMGELVTVHAPGLPIDVLE
TKIKSLKLFSNEISEQQAKLIALVHMFDQINHSLSEDGVNGVRDKLKSAKDRLTRLSDDA
RAQINTNYECIVEQQSFNTQMTDFSNWMDQIRTSISELENTAVDEIELAAQNVQYLVQQH
ADKRNTFNHIYAQVKQRSLTNNPMENQLLNETYSSLASNYQNLESSLLQMRDFLQKWLAF
LQWHNTTKDQLAYLRESMIKYDVSSEEQLNDANRRIQEVGMGLENWRRLSLAMEQEPCIS
FHDKAHKPVSAITMIADLDHKLSSIRSQVDGKLKEVENTKDRVAKFHQSQKELTDSLRGI
EEKLKGIVQAARLSTLDDGMEDLSTLNEKISELCSAKAQVQYEGNLLLKQDVVDTGIAVQ
EELSKLDKKVTDLQQESDETLRAFSTTSDLYADFNKYNMSFANELKQIEALNNATVLNFD
SKPALQQALDQLKKASETMTKKVKRSLDVVAGKGNELAKTFRAYNPTDCDNILDIIRHNN
EQFKANLERLIDNSSVLDQKVALYKQAEELYQDLDEWLQSKRDQLSRVLENPGEIESKIV
TYRSELPAQQAFKETLEGLLQEFKKMNGGSLPKDLHSMSMQLDDGFAAIEETVGRLNNRM
SEYTADERRLKLSIKGIIERIYSIREEIVGCDDMTLDSGKQLVHLAGCRELRRKLNRVGE
EITDLKNEFAAMEAKYDQGIKEASTVGKEIQNLDQRFGLVMNSLNEVETKLTKGVEKSFK
DKLGALTRMIGAQSEKLNWCAPEPTSDKYQLEVKRTTLNDVRTSTEDCERILGEVERSLT
GAVVELFTPAKVSNMSDETQEVSKQLESLKRAFQETEKQLTDNIALWLSYEGISEEVIHF
LKDLETRNRMETVLLIDLASLGEKSKEVGEARATLEEFKVKMDQLQSVGNQLNEVNPESR
ALVLVHHLQNKYHTFSKYFAQLLDRLEDVRLKDVQFREAVDKIRHWLREMQNKKHAQNLG
AEAQVQALSDREYEAAKALRAEILSKDSALNETCSLGENLYAEVSVECRESIRDEMKRLR
GDYNALLEEVSGGIKRIEADLIKKKSIDESHNQLNNWLAELRGKITSGLSDRYATLPEKK
SALYSGKNMQKDITVHETNLDQIQKKVMALPDRSSLGQIEETRQNYGALREELDRKVALL
EQAIKSHEQYNAMLEKSRDWLLKLQSQTEEMFSDGDLTKAKLEEYLILVDTVLTEEEPAL
DDVNECYKQFAVVMAQTHENGHSELLRAFEDGKRQWTTFFDKCRAFKARSAESLKQLDAF
NARLEGALVWLASKKAEIRDATAQGPLDAKQQCLESLKKLRDAIQSYGVTVSGILEESHQ
VKSKFDVSGKVGQLQNEYRIVAGLCAEAISKAESTLHDQSDFNQAYDEFEALLRKNLEGL
EEFRVLVGDLSVLQERQLRLKEIAYKRLDDSSPYEDLINRGEKLYSYTSPEGRELIRQKL
GAIRDLWDRFSDELNTVTQRLDQCILQFGEFSLQQEQLSKWLKDIEKSMEVNAELKANIQ
DKRTQYQNHKLMHQEILSQVGLVESVCAKAQQLLTLTKDQHLQSCVVSIKDTYQGIVRKS
GELLENLNACVQAHQSYVTAASKLRSWINEEKDKVFCCEETGGEKGEINKRIEALSNLKL
GKAKGDELLNALVQCFEAMKESTSAAGIGTVEKEIGELRNELASLYGQIEELIGSQRKSL
TGWSQFDQDLDALTKWCRSMEGIFREQQLYDSLERKQQQLEVFRKNQEAIGDKQKQIDDF
VTMAQALFTKTGVEKIKFYINQLINRYQLLQVLSKEVANRAQNIVNDHKNYQERYNESAA
RLAEVEKDLETLGQEKLGAANQSKLQQLEIEKERFENNLTSLVTASEKVLPETNTQGREK
IREEVRELKDRWDQIIAGLDNLKKQLDVRSIQWSSYQDILQQVLSWLDATERKIEPNESQ
SWNSTQEIRSKLFKYKAILQEISGHRRVIDSLKEKADSLGADAQNEDIAAKVQSITERYE
LLKKSCSDLIRRLEQSLELCNKFNELQKSLLDEQDYLFGELKQLSDVSGNKRVVQEKVQK
IDDLQQANGKMEEKFKNLAKLITDNNDLISYGAKTVMEQDLQKMKADFEKFIGSIGDARV
ELQKRMQLWDDYQRDLDQIGAFLAEVEDTMRGYTLKSSLNEKQEQHEYYQTLLGRLKQNA
LEFDKLLDKSSELLQSSGDTKISFNMQQLKARAQSVEGTVKELAKKCEAAYGDHKQYRQR
YDECDKELDEIRDVFDGCRMQHAQSIQSSNQQADPQAVLGTIQTLLAKHNVVTVQCNAVS
DSGEQLYATTASKGQQMIRSEIQELTAKCERLFDEVNDYARSYEGRLAKLSGFMEKADQL
QEWLNSVEGQLGRGSLILKPTLDEKCAQQQAYAELLNDIKNHRPELNNVRDLVDNMQEQH
PTIERRMAELTSKYEECLEKAQTYGDQYDRIVHNHRQYCKAVMETQDFIDANHNTVELWG
ETDLDQVSLMTNLDRLTELKKSITAEQSRVDQIRTLGEATIPDTSDEGQANIRSQIDISQ
QEWEGLLAAIDSTMDGIRGKMGEWSDYEKIRTDCMNWMRDIDAKIHSVDLKATLIDKKAT
LDYLKSLQGEVKAKELEIDNFTEKAQQLYRGYLSSRNSQISELAVKYQQTASRIKELVGR
WQQYVIQHQELETRIGEHRDWLNGVREKLNYCADLSSTSEKELQSKLKLVQDMIVNKEDG
SGRLQTIVDLAQQVLACTTPSGHEAVNKAVAALQEEWSSLALRMIDIRANLDEAINQWSG
FLDQVNDLKRNIDWMENELSGFVEFQASMADKRAQLERIKNTEEKIRLEKIEIEPLKQKT
TEMAASGQQSQAAATAQQILSKFDYLAEKISKILTDREDQYRDHRLYKEAYDDLFNWISR
AREKLPCVKQQSLSDKLTMDSAIAPLDALMNKKAQGELLVEHLVHTGEVVMASTSEKGKE
AIRSDINGLKANFESLFGDIDKQKRDLEKTLNLLREYKEEYERLSEWLQQVDILVKNHKL
AMCSNLAEKEKQVREMRELIGKLEKGQGEMDKFNAFAAPLLQSHLDTYIGNQLRHLNSRY
QVQVNLAKDVLKKVETNHDLHREYKDNLTKANGWIENAKEIVRYSTENVDSVSKDNLEKR
LAKIVELIQQREQGQNLVNATVNTGEKVVKSTKSDGKEVINGEIKDIQTNWDRLVKRMST
AKVQLETNFLQWADYSSSYNHLQQWIQDRESKLQQVCEQKVVRFRLGGTSSSLSSGLNER
RANLRQANDIVQDIVSFEPMIQSVASKASDLRQTSPASEISNKYETLSKQAKEMFEKQKE
TVELHQAFIDASNEFAAWIRNAKECLNKCSDSRGDKETLVSKMTQLKILDNDVPVGQKKL
EKALEQAEVACRNVEGEEVEAIEKEVAILQEEFDNYCIALKKISGALENGIVRWTEYDDQ
YGVALKWLDSIEQEVQTYNKMQANLQEKKRVLEEFQDKLQTLFDWQRELDSLNMRAQVLL
EICADTRISNGVTQLTTKYNVLLSIAKEIMRRLELHYQEHQQHNTLYGECQDWLDRMREK
LNECESVPHTVAETQSKLNIVKGIRQSLEQGQNKLRYLIELKEKIVLSTETSGASKIEED
TENLKTEYESLMVDITETRQRLTNHLAQLEDIGKLSRMVAEWVEEVQGKLDAGETMQNEL
ADKRVLLEKYRAIQRETGNYNELVEKIKSKMTDNANIDVEEFNKILTDYEAIVAKVVAEI
ERLENQVNNHERFKQALGELYEWMKTTRQTIQQSSDFHGDKEHIVGRIEKLKGIELSFAD
GKVLLDNTADMGNSLAAISGQEGQATIKQELLQARADWEELEELARSSRQTLEDCLASWD
SFLDKSETLGAFLEEYNVKVNGYGASEGTADQAAVLSELKRIQDLILTKKSTVEELNDVC
EALMEKSACSTVRDRTVDLQKSYSTLLGKVQGFITKLEKNLVSHTEFLYYKEEINKWLND
ANATIKNCSDVAADDVLVIRQKVVQLQSLSNSIPQGQKLFEMLQDSFTKSSYLYPEDKQT
TMFQDISDIRDSLDTVIIGISSSLNNLNAQASRLESYEELKRRINEWLATTEGVFEALPE
THGEMTEVKTLLERLKHIQTEISFKQSDLENLQQEAANLFDVNKCSAEMERVASLQARCS
KLSEKCSYQIRNLETELDDQMAYYQNLQEIEKWLLQISFQLMAHNSLYIYNREQTLEQIA
QHEKLLDEIQRYQVNIDDFNAKGQSQIERYILKAPAIKSRIETQMKNIRDSYNSLLNTSV
QIKNRLHDSLNKFQEYEDTLDDINRQLDETEPLVAEERLLEVVDYAVGQSQLEKAQGIHN
KLQVEKSRLMFAVQACEAATASISRPSSPMDNVSQMIPEKELMVRARLEDLIDDVQQWIA
ELITSINDCERQHKQKVELENWIQKQKAIVADWGSKPCKFRPEAAEQELRAMSELSRTIT
VKRDDLQGETEQDYRLREELEKLQGSLKKVIDRKKDDQLAIEKYRKNYEDVQGWLDAITN
QIDNVEKGGGLSCKQKLEKISNIKRILENDCEMIANFKRNGDHIVELVSNLDAQQVTEQL
KSIDRRYNDITKRLNRRLDVIDSTSKMFGKLRNDIGELSQWVVDKNGSLDVPYQLGSDTK
SAENQQQAFRSLLKEIEGKQSYVDTLGKRFSSIQSDLEPNEKQQLETELQTLTKNVGLLS
ERVRAELDKIVEDILCRKNMHNNLDVTRAWIKTKQNDVNKISDQIPLLSSNVNSEIKLCQ
RHAQTIREFEENAFKDVSKQVREIMKDCSEEGKAKLAQEFGDIESKLKELVESCARKIEF
MEREHGKRREFEGRKDRVWNWLNEAESIVSADIRTTSYEILKDQKQKFDKLCGECEVMKG
VVKEAEEYKSAILPTLNELDKTNINNQVKVMREKWNAISNVLKVKCKKLEDHLVEYEDAL
AKIQSCAAFLVQVQGRLKEMNRPVTSRIENIQDFLLAYEQILGSLKDKRLEMSTILLTNL
PQLRENSAKLEEMIMGIEEQLRRLKAMLLLKEQFIGAINDIVKLIAKINTDFNTVDNFSP
TVDERLMRYSEILQSIEECEGLLVAATDKGHQIASDGTDLDRHNIMDQIHSLQQQLGSIK
RSIELEQDKYQKQRAYHKTLSNDLFALVDWFKDNDEHIRSRPLFGLDLKMADQQHSAHIA
LAGKANINLKMIEDLLGKLAHSDSKLPDDLQDMVDRARALQETIPAELTAREAYLTQNRQ
YRLEFRDSMERVKKWLTAAEERFEHTKTFSFDQEKITVALKELEDFLHGEAEIRTLLYGA
IQEQADRLWNSLSELDQNQCLGELQQLKNRLSEVSHRAAVQQTELLSNSDLVKSYKKHSS
AVNSVLAKSKLDDTILTIPTLPARIDHINVLLNMLQVQQNELDILNELSQQIVNRADQYN
RDRVQKETGDANRQWAANTSLLETLRENLVQLQQQWDQLESILQELEVKSNLLLEKDRGL
DLVVHSRDQTEAKKHIVENLLEDKTALGQLNTKANALAKTLIKALREQKLLPQSLEEKLT
HLNDINTRLSDNLAKKERQLRDILTELQHYLDQIGELAQRIETVRKDLTQINPFDERLYQ
TERALGAVKEAAESCSVQREDLRRRINEQYLPAQKFVPSDLKEGLELLDRSLSGISGTME
DYQGAYKKAKMIRTDYFTVYDRIKTWIEQAELTISNHGIDPSELKSKLTTLTGEFGDMRT
AHEQLLFNGNEIVRHCTESSDRTATQANMDQLTHELDKTIALIEQKNQTVDQILGNWANF
MRLYQSVVDWSIKIRALLERKLQLNTLHEAQQACQNYSGAVASLADVSQNLSEMNHEFDK
INEVCSTAYLRGKLHEAETLKIDIETVLFERNLFLHETTEEWQQYERKIESVREWIKDAY
LALNSGELKSKPLRDQLRILEQMLADISAQKIKVNMSLEKLQVHFHSDIIYTDNPTIVQS
GRTILADLDKLNLDVFQTTQNLDQALAQIEGCQAEMQTIRQRIVHEEQQLRNILSPLHQT
GDSEKHEQVKEIALMNAREEAFLAEMSGKMVHEETTIEHDVQQPSLPIESSSEEIALMNA
REESFLSEVSASEPDVPQVPECSAQIEVSSEEIALMNAREESFLVEMSGPAPTTDVHIQT
MPKEEFMPAGPSAEEIELMSAREESFLAEMSGQHSDVKHDTDAKTDDGAMSVVVSTEEIA
IMNAREESFLAEMSAPITVTESDVVLESTQDPISMAPSAEEVALMNDECSVVDVTVVSET
EPDISSAIPAEQSILDSSMLSETDRSMGEQLIETRTMIVLEESEGDEERVVREMCQESFR
QDDASSVEVAKQTESLGIATSEVSDRELAEIYRTLEQSYLSMWQLRDAENSYQKLDAREA
KAQAEEVVTETSIPCDTPAEALYVEETISPDKPEQSSKLIDQFEVMKTLSQSMINNWQLR
EAELSYEKLRTMEMVKDSETDRTENVQIESPKTEDSVLIEDKLLEETVSPKDNEKQELLK
DSMDEAPELVVLETTAATTSAETDSSPIESLEVMDVHVEESIVLPKANDQSASSVVVEAK
YTQPAEGKESERSSELLVKNIPTQFETTFVEPDETTTEIVVNRDGSKKITLRKVVQPAQS
IESTITGKASIVTSVELAPEQSDAPAITAEESRVVVDVEGVDVVLEEQSTEQKQQEDPVL
EASSPPAVSDSPVLETAQTVVEEVLEQLEQKLITAEQAVEQQQPDEPLTEPLTAGGELSV
PVERPVESLEDIWPPSQYVCVDNVPERSIPVSPVHVRTEETVEVPVQRQESEEAQQVWPT
SPERGSDYIEIEPNVMKPQEVKEEETIVPIVMDEATLEHVAVDRDQEIEVPIVMEGVISV
SSVPEPADTTGEVLEQTVQVKEDLPIPTQVAEVPVETIVVKIEDENKQLEPIATVIAESP
TVTDESTLEMIETTTLSSEPVVETTITRTTDTIEDSDSCTTIQEQPAPPELVDDEMNLQV
QVASIGETQSSSLRVSMTVDPTETKKISVSLIEIKPSTGAALEEEGKQTAVPESLEFEEI
SGLKAVERKKKGKNENEKASNTDQSGPEPKPAAPADGRLSVAQESEQRFDSYQSFTEEDQ
PQVSTVNVLEEAVEPEMIEVPITIQEKIVVPTEVIEAIYTEDVQQQTTPIEFASGRSDSV
DVEIEKITSERLMVPIDWEQRSMQTSPEPVIQRTSQQTSPLTIEQEGTDQETKEIQTTAV
EAAEIETQTAQPVELIQQEAQTDTVEESPAAAREIDTVDMANQTVPIETKETQQQAENAE
EIVGPILGQIVKEVIDPATLYKPSSMQTSPVHFAEDAEAPKEGADVQTADESAQTSFPEV
QDANVETETVSVEDRANSPLAESPAEYEIQDEILIQTVAQPSAPILESVDMQTVQVPTME
SDAQTTPVTVTEITETVTISTQTKQQESAPAAEEVVEPTHDDKESKNKRDKKKKSKKSKD
KLIPIEVEVSTQMVVPSMSAAGVPLVGAVGSESVDIDPSFGTVEQSTMAGSAKPSTTVSC
PINESLDTLQSQNLQLSLSDCFSIIKSQQNYAENRVIPWQDINRMMMSIKFPSVSSAEGD
DQRGNAYPIICSTSLPTEEDDTGAANDDLQHVLQLLQENENNPAAQQHLLFNVVENVVKS
LEDLDTGVAQANVTDGPSSVERAKLHRVYKIRLIRIEEHIVKIITYVQRSKTGPNKEVDE
CLNHLLRQVKALEQTVADGEQKLDANATELRTISGKVRSLSNTVAGIEGTFGDLVANDTM
YIATKLCMIREFEMNCRVAQNSLTACTNEYNSRELKSEDDGKLAGEMEQIGHQLRRLENG
LVLESNKLIQLGSLAEEYEQTLLEFQEITATAEVFIENEIVTNSLEELQEEMQRYRKFFV
NLNHCKAILESLETNLDPLTRQKYAELHSSLYNRTKVILERAVDRAGKLALAASRWTVLE
KDMVAEQQWLQVAQQRVPDLSNVSSQDYERYITMYESLDQDIGNHLTKLRSHNETARRMQ
ELISAPIVEKESNDALVVAMQLKEEVSLYLRLLTKFKTHWNQYNVHADRLGDWVHQNEGR
LAYITIEKNLSETSVDHMRTFWEIKAQYEVLNNKVYKSACETFDRALDTIPVTDEQLQRQ
LHGQLLDNWYAVSSRIDNIQRDITDSMKTEGTPPSDKLAFIEQELQEIAREFDSTKSVLK
SHDDLYLYIERIHTLKTRIQLIDTELVSQFALALDCDTEEVNAIFTRSRFLLHQITDELQ
AAETFYGRLEDIEQGIAAQEQRLADISRVLDECSGSVNGKRSAIEKALADCKTSQEALGP
CWNELMRLRQMLHTLPMNLKVSVSPLQTERDLSTLQNVHNDLEHRSEEVMTLLRNRLALW
NKFHKQLDMIQEHVQETEFMMELLQLQESADYNRLLKATERLDTLLTDIESRKGMIEDLH
TIAQPLVETSDESVSAEIQETVQQISVVWESTRENLRDLCDRYEKAVKLWQHYHDVCEAV
KDWVNHEYTDYDDLHRLEDLPQVEVYQQALLDQRQEVEKLRKLIGDINEQVGFNIGDTLL
TEIDECSKKLEDIERNVVEQRSKVHEREVARTEKANTVQSSRGLLNHIQEQSAHSQRTAD
ENLYNKIVDLRSYMLSLCGTIARLKDIQREREPADDNGNLQNLHSISQNLLQDSFQQYQE
LVQQLVTQTEDDERLLEFWQEYLQFVLTFLSEPIPSDYGQLKAHREQCRLIRMLLISLRK
VLLQKSKIDVRLVERFNELSELHADRIDRFSERITETDNRLWHWEKFRSLGDDLYEALAN
IEREKFTLQLEYINLQELPKLIGKVNGLLEQFPRLDGDLSAMNQELSQLTLYTKDECTLV
GMRSEQGKIAEKISKLQDNVETWKNFLFGIEELHGRFGKQSYEVETSLRELQECLDELEA
DQRSTAGSGMEHRLSGVQARLNLVKNHHVRLNTVRANLEEVGQVQEELKACISMFDVQRL
HKRVWTLWQIYSKLEQRIVLQVKRSEEASRNRKLFLEHYHSLTEWMRLFENKLNDTNKYE
SCTDDQVFIRSMEESMRQELALKECEKDWLTSMGKDLLAHCSTAEEHTEIMNHLEKLHAQ
WDYLWRLCDSRAQKISEIEVTMRSLELRIAELRAWMETIERELRMPFAVDSLEKTNLDRL
LDDYEKLQRSIEGNSGNVAEVLNLCEMLFIDVQSWNVHINRRSIQNDAKDLDWRWKNVCM
ESGRRKQDLLALWNMLLELQKIVESHQQWVHEQHAYVRHLEQSASSLDGDQLADELESIA
IRMNDVVAQEPIQCIMRRLYISVAHHDRISADGLRFLTAPAQQMLLLWERLHVSLTSLRT
EVERYRTEYGTFVMEYERIILALTQIDVQVTQIEHIPPEQTADGPLSAEARIDRLRELHS
ELLFVVNLFEKEDTLGAGLIERHANNNTMTEDIRQKMAEYHELGNSVKTRLDALLTRATE
AFEVRNEKEVAVQVNTLRLERSESITAKDAYRYQLETALTEADTNLRKLEEAIEAINANN
FMSSTQNVSKASAACESSIELIKHLSTLLLAECHATVEEAFTVRVKEETERYHRLLTVWK
EKQEQLEESRIIPNAYNFNCVHNADYLTCPLCTNRNWQQIDNDLWRLEQWLAMAESTQRN
QLSSPPSDIDALEDTIQDHREFLLDLDSHKSIIKSLNIVGEHLATHTRDTDRAAKLRERL
QKNNRRWDAVCTGASRWQSALNSALMENREFHRTIAELSGWLEQTENKIKSSEPIDLTSD
QRLVEKKYRMFRELRADLMRCEPRVVSLQETTSQLTKYVDANKSEKFDEVYAKLTDLRLR
FHSIRRLVEMYIIKIGAALGYDSSTSLAEIPSSSSNASLATVDRQQARRRQASEQQEGDD
DVINTTILTRSYRFLGRVIRASLPIQAMLLLLLGVVTLMPHGEEYSCTLANNFARSLEPM
LRYPNGPPPI
Download sequence
Identical sequences Q7QG88
AGAP009554-PA|hypothetical 7165.AGAP009554-PA XP_310129.4.40869 AGAP009554-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]