SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP011396-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP011396-PA
Domain Number 1 Region: 175-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.69e-32
Family Calponin-homology domain, CH-domain 0.000028
Further Details:      
 
Domain Number 2 Region: 7266-7425
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-31
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 1461-1526,1602-1714
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-27
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 4 Region: 298-415
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 4068-4208
Classification Level Classification E-value
Superfamily Plakin repeat 3.86e-26
Family Plakin repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 2256-2326,2354-2488
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-25
Family Plakin repeat 0.0079
Further Details:      
 
Domain Number 7 Region: 1703-1928
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-25
Family Plakin repeat 0.0047
Further Details:      
 
Domain Number 8 Region: 6288-6449
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-24
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 9 Region: 7171-7314
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-24
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 7061-7204
Classification Level Classification E-value
Superfamily Spectrin repeat 4.54e-23
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 3438-3645
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-22
Family Plakin repeat 0.0075
Further Details:      
 
Domain Number 12 Region: 4294-4405,4442-4481
Classification Level Classification E-value
Superfamily Plakin repeat 2.96e-22
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 8243-8319
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.14e-22
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 14 Region: 5549-5685
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-22
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 15 Region: 6405-6556
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-21
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 16 Region: 7505-7644
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-20
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 17 Region: 6840-6985
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-20
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 18 Region: 3611-3743
Classification Level Classification E-value
Superfamily Plakin repeat 8.11e-20
Family Plakin repeat 0.0037
Further Details:      
 
Domain Number 19 Region: 7707-7829
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 20 Region: 1932-2032,2081-2162
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-19
Family Plakin repeat 0.0079
Further Details:      
 
Domain Number 21 Region: 5876-6009
Classification Level Classification E-value
Superfamily Spectrin repeat 7.8e-19
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 22 Region: 4500-4698
Classification Level Classification E-value
Superfamily Plakin repeat 1.12e-18
Family Plakin repeat 0.0089
Further Details:      
 
Domain Number 23 Region: 7858-7971
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-18
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 24 Region: 7391-7499
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 25 Region: 5043-5195
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 26 Region: 705-826
Classification Level Classification E-value
Superfamily Spectrin repeat 3.99e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 27 Region: 2505-2664
Classification Level Classification E-value
Superfamily Plakin repeat 1.26e-16
Family Plakin repeat 0.0097
Further Details:      
 
Domain Number 28 Region: 7925-8047,8103-8133
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-16
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 29 Region: 3915-4011
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-16
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 30 Region: 6715-6842
Classification Level Classification E-value
Superfamily Spectrin repeat 6.17e-16
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 31 Region: 6518-6657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000102
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 32 Region: 3814-3915
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000034
Family Plakin repeat 0.0059
Further Details:      
 
Domain Number 33 Region: 2610-2692,2725-2813
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000157
Family Plakin repeat 0.0081
Further Details:      
 
Domain Number 34 Region: 615-744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000113
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 35 Region: 6070-6222
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000336
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 36 Region: 5799-5904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000038
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 37 Region: 4216-4309
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000654
Family Plakin repeat 0.0061
Further Details:      
 
Domain Number 38 Region: 5250-5374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 39 Region: 553-647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 40 Region: 8153-8234
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000268
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 41 Region: 5441-5575
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000504
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 42 Region: 4937-5043
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000608
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 43 Region: 4786-4928
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000547
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 44 Region: 1184-1285,1319-1343
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 45 Region: 3738-3844
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000314
Family Plakin repeat 0.0078
Further Details:      
 
Domain Number 46 Region: 6992-7098
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000154
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 47 Region: 5650-5777
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000408
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 48 Region: 1112-1214
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000101
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 49 Region: 953-1102
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000032
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 50 Region: 384-514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000208
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 51 Region: 3349-3406,3439-3491
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000196
Family Plakin repeat 0.02
Further Details:      
 
Weak hits

Sequence:  7165.AGAP011396-PA
Domain Number - Region: 4702-4796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00016
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6663-6726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00264
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP011396-PA
Sequence length 8583
Comment (Anopheles gambiae)
Sequence
VVQSRSSSRSSGRGPAITTNLDDSNLRFRHEILNEKVIEATVTELPDVIDGINRDHWRAL
PSSLAYGNELVVGGTATDPGGGSSTVVAEVTRNKRLSTEVLGSTLETTKSSQRAADGHRR
MTTHIVRKITTLTRAEEQEQADNMIRQNRDVKTTEIGYMRTGRLDSKRAKISDIVVGQED
NLTAREALLRWARRSTAKYPGVRVNDFTSSWRDGLAFSALIHRNRPDLIDWRESRSRRPR
ERLEVAFHVVEKEYGVTRLLDPEDVDTNEPDEKSMITYLSSLYDVFPEPPQMHPLFDMDS
QRRVQEYREQAQQLLYWCREKTSLLQERAFPTTLIELKRLLTDLNRFRTEEVPPRQRDKQ
HLFSIYKELEKYFESIGEVDVETELRPEALEKAWHRLMSALADRDSILQQEVQRLERLQK
IAEKVQREYKHTETIITKIETRISEESRRIERLHPVEAKNIVEGLDGDIRHLEQPLQEMN
DDCHNLKDGRYPQASDLHKKVTKLHQRWSQLRTTFHTSLVQKLSGLSYPVQETTITKQTR
VVTETRQIGTNPYFRDVQEYTEWCQSKLKQLHTSDYGSDLPSAKVELERHQHEHKVIDQF
HSKIAQCERHASNFTGEELQLYRQRLSQLQKVYAELLSTSTKRLSDLDALVDFLATATAE
LSWLNDREQIEVSRDWADKNLDLSAVHRYYENLMSELEKREMHFATILDRGEALLVQSHP
ASKCIEGHLQALQSQWSWLLQLTLCLEVHLKHATDYHSFFDEVREAENWLTKRDEILNSK
YSQSEFTLDQGESLLRGMQDIREELNAFGETIAQLQHQATAIVPLKQRKQPVNRQCTVQS
ICSYKQGNISLDKNETCTLLDTSGRVKWRVKTSKGVEGSVHGVCLLLPPPDQEAIEAAER
LKRLFDRSVALWQKKQLRLRQNMIFATIKVVKGWDFEQFLAMGAEQRTAIRRALNDDADK
LLAEGDPADPQLRRLRREMDEVNRLFDEFEKRARAEEESKQASRIFTEQCISLKTRLEEM
ARELDHIILSPMPRDLDSLEHTVQILEDYKRRLGGLEPDLKHLQETFRTITLKTPALKKS
LDNLMDLWKELNTQAGLHGDRLKLLEGALAGLEDNEQVISDLEGKLSRQLELPSTQEGLY
EVYKRLTAIQETISSQQPEMDKMNDSADQLGRMGVPTKVLGDLKRLHSNVERLNSRWNNI
CGQLAERMRSVETAIGLMKNLQTSIVVEETWVEKQTEKLQALPTATSARELDSMLGETVE
RIPKVEQVNLTGGRLIREAKIYDGKCVHYIDWLSEVRPSFSPPRQDLRPANADPGATEVY
SKRLDTLNGRFETLLEQLTQRLKTAIEVNGADGLRYAESLHKPLRTYRVEFNLGRPANNG
TEGHQENGMPTTAASQLRENGSPTKAKPTDGGGYPTNGASSVQFTEIRSLKRIQRTSEAV
GTNGDEDGAALLGDGDNILNTPGIIDPTTGRTLTVGEAIRLRVLDVRSGLLNVSTTGERI
SLEEAALRQLIDPALVGKLLRPGAAIDRDGRPLSLLEVIQKEILEAENGGSYESTEKRIK
VTTEGINERQHSGSSRAAIADAKSIVDAIKQGLVDVTAGGGGGLYRTPSGRELSLADAYE
CGYLVRSEAIKIAPHTLCLADALAQGLVDTGGWVTDRNTGDTFRLDSAIERQLIDPHVRE
VVDTKHDTKVTVAQALEQGIINARTGRYMNPQTKEKLTFAEARHRQLIGKPLTLKDVCDL
QLYDQSERIASPTRRERVNIPGAISLGVLDGENVRSIFKTSGAELLTLAEAMDQGIVLPF
ENRYRHHETGELMTIPEAVDRGLISSVSIRSIFNIHGFKDPHSGEFVSFNMALAKNVLRK
RDGQFMLDSGKGVLLPLGEAVGLGLVRPEVYEMFNRAIGVQDDRADRELSLIELVYRDHI
DPKTGFLLDAARRVLPLEPAIERKFITPEGALLLISLLNITLTTETVTKTIKRYVTITHT
GEAPEGQPQVLLSFTEAVRQGLIDEQTRTYRDPATGNLYSIQQALNHGLLLPDTEALPEQ
AAGGAPSIGGAAAPIQFETRVIKGANSRTLNITTEYLERADSELQTFELPANGWPLNEAI
ERQLLNPDTGLLVIPGTDRLVSFEECIKLQIINRQSAFVSDPKTPERRVTIDRALEKKIL
DPVGRYSARKGAEPLTMRQAIEQEYIIFEQCLPSVTVADGSENRTIQVTKRTGQPDRVEI
SNPSAKNSTLVEVKVVATPELMSPEPLQLAPGVIYDPSTALVIFAETGRSDSILGAVAGG
KIDPSLVQLVDPANPAGEKLSIAEAIKRGLIDEQTGEIRTASGPISMIEAIQKGLLLVAG
APLVAAAGAIDSLKLFTDPVTGEEIPIELAYERGLITRSQLPSPERAALLRKKLSEPKKL
QKMRKCVLRPKDAAEQGIIDAETAQKLEDPALFSNPSTTLADVLKSGQLKGESGRIVDPQ
RGHVLNLKQAAQRGILDLHGTNMIFVPIARCLSLPALETQGLLNPSDSRIYHPESGQLLT
LREALLCEIVDPLAEITVNEQSMPLEQAISAGLVDEDRCTIGGDLKIADAIDRGLCQPSN
YESKIPPIGMSLPVVVERGLLDIARKEVTHPISRVPMPLESALRNDFIMATPYTPDVDGV
QLLDAIDRGRIDTTKGTYKTPLKGTAEIVDIPLREAIDTGKLIVKPLPKLIQNLQANHAV
TSVQETVAAFHTITTKTVEIQSGYALISANEVQDLQTGAIMSVDEAVKQGIMTQPEETRE
ELTQQEVKIGLNEALQRGLLDVTKGTFIHPSTGEVMSISVAVDRGFIGSHSSSEETLNRS
PEMSHKAIGKVDVAESTPSDSPKKTVPLEASGQLGPMSQQPSGTPVEGVLDRSQVAQSAP
SAVASNSSTAPSSGSNIGNNIKDAAKLGLMAVVGAPVLGGMAIAGAVKKAFEKKDKGDTV
SAAGFEVVGNIEEPTVPFVNLATDEILDPTANQFAQSQPMVDSSALKMPAEQDTEKAPEA
IEALENVKQLAKAMVEPVKPEENSTVKEELVTPTPVGTDSEDQLLAQKKPVKSEKDSLSQ
FLDAEKSASAAAQLPQEQAGSSKLAEAFTDVESGASDKLPAADPNTTAQDAPPNDSISKS
KQTTEQMPEVVEQSLKVKEDTTPLETKSVEQVVVPQTKKGTDSISDSTDANNENNKLASV
PEVAATSGSSAIADVKASDASEKQNQMVSQEAPSVSSSEEVQKTKTIPEPTTHSSSNSSA
IEDVHVAKPSNVPTAIPEEEIAPQLLGDVSSNFQKAEVPSTTDGGAGSKLMDAAKLGLMA
VVGAPLLAGKAVVDALKSDKQPAAVGEVVATGVEPTERHVTFVERPSERPERMTLGEAIS
QGKIDPKHCRILVDDKQMPYTVEEGLNQGNVRIYDVVDVLSKERISFVEGEEGDDALVLD
ASLTEQRLGELGVYDVEKGYFLDPTTGERVSFRDFIYNAGALIDSTTIFVKDLGRNRFER
LDVALKKHLIDKHTGHMLDNKTGKKIKFVECCRRGWIVQREPAGDEDLSPTLAEVIDAGQ
INPQTGEFIQNNESIPIAEALRAGFIDNDSLSVRDPTDGQIVPLAVAIEKGIIDLKLGVL
FNKDTQEEIDLNEAYVKGYMLEGKRKPISLEAAVLKGLYNPESGLILDTITEEMVDVQQS
VDKGIVDPKISNVKDTKENTLVPLQDALDMKLIDAESGKLKDTASDQLMALDVAVEKNLM
DTKHVTHSLIDVLSREFYNPATGKILDPANGDESNLKDAINTQLVEIDSVLIRDEARESV
VKCRDAIASGLVDDVRGVLTRPELTLDRAYQKGYVLSNKKPISLADALLRGFYDPTTGKL
LLEDAPAAVTLEQAIGQGEISTNDLIVRDPKSGTVISLAEAIRSELVDPAAGLVVDSASG
LSMGLGEAMDRGLIVASKRRCSLPDAVYRGLYDPKSGQFSSTTTPERMSTERAIRRGLLD
PESTIVTVGGKIVPFELAIENGTVDVRRGTIRDDEGVRIDFREAFDRGLLVEVRKPIGLS
EAVLKGIYREGNGKFVEPKTGKKLTLEQAIAGKLIDRHSVQVRDATTGYYKDLDLNEAIA
TQFIDGDSSKVRHGDGLITLKHAFDIGLLYDRKAPVSLQRAIHQGIYDDKTGKFVEPATG
RKITLQEATRKFIINPQLPCYFNERDETMLNLFEACRAKLIDRREGVFREPGSEVFIPLS
EALALGLIVDIESAGFGLYETLAMGFYRPQTGQILHPITGRQITLEEACDEDIVSPAASI
VKIASTGRYVRLDEAIEQGVVDAQAGMYNLPEGKINLQEARRRGLIVTNQKLLSLEKAIK
MGLYRGDEGGFVEPSSGDLLNLQEALDAGLLDFETTVYKDAITGQDKPLRAAMHQADIDV
DKGKVLDRKNDRAYNFDVAFGKGLLVTVNRPITGKILERKESIDNLLQESPIGRGPKEMS
LQDALRHDLLSLEVSVVRDPRTGLFVPLRQALQDGVLQEGARATVDPKLLFFTFDNDCVV
YVREPLSFDRAVECQLLDLTTGRFLSVPSASSTAQPGPAPSSEPSAATITLRDAIVQGLI
DPESVLLKDGAKRKLLHLPEAFRKGLIEPEKSNVLDTASSKLVPLQAAVETGLLTTPRRA
FGLLEALDYQLYAPAEGNFRDPFHHAAPARTLAATIEAGLIDPSTTVVRDSVGKGSAIVP
LASAIASGLVDAARSQYHGDDREPIDLVQAREKGYLLLAEQRQAVIEKFALCEDHLAKLL
EWITRVEQDIAAVGGPKERVDDLRNQINSLKQIKEDIDGQSRPVASCLDQVRQLVLTGGD
VLSAPEVAALETSGRELRARVDKAQDRTGKLLRRLGAARDELGKLRTELDTFSSWLQSSR
RTLEDKESTLSDLHNLPSQSDTVKEFHSDVIAHQADLRFITMSAQKFVDECKDYLGVLND
FRTTLPDRLPHIEQISSSDSPIRQEVSLVTAQYRDLLNRANALLDRLAGLGNRQRDYQES
LEKVRSWLRDVQPRVSSVLSDPIAADPQSVQDQMNQTKALQSEFLSQGRLLDNVQHSLDA
LLKSLAGRLSPSEVSALEIPVEEVKDKYSQLLEALGDRSKLLDTALVQSQGVQDALDGLA
VWINQSEEKFKLQNRPASLIKDRLNEQVREHRGLLNDLESHRTSLESVTLSAQELMATPS
NTRLAKRIESNLSDVTGRFEKLLDKALKRGEFLEDTMSQLTKFLNDSSNLEHELTALNEA
LEGRELASLPAEVFAQRMVELSRLKEDLRPQYEATVRLGKDLVAKRDVTDTGVVRDLVKV
LENLWKTTVTTLEEKLKLSKQKAEQLHAYENLKDQVLVWLSSIETRTNNLAPVAVDVDAI
KFQIEEVRPLVKEHREYGVTIDRVNDLGAQYDALIRPDSPTRKRSVYSPIKRSNVSPMRR
MSGDARSPSPTKGGPSPLSPASGSSGFGSRRSSQDGFQLTDLTPIQQQLTEINNRYSLVG
ARLNDRQNELDSVRDEVRKHQENLKTLASFLDKIHRQVPRDVIGNKEEADRCNKQARKIL
EEMYERQSLLDSTKAQVKDLLKRKPDVQGAERLRAELDTVADRWKNLNDLCKDRITFSEH
LRDFLDTHDNLNTWLAAKERMLTVLGPISSDPRMVQSQVQQVQVLREEFRGQQPQLNHLQ
EVGNAVLEHLRESSPEGQAVSTKLRNVQKKWDELVARLDERAQSLGAAADSSKEFDAGLN
RLREALQTISDNLDSLPTDRDHQETLRKIENLERQLEGQRPLLADSEAAAETLCRVLSDP
VSRADVNARVAAVGKQYQTLQKKLDMRKAETDAALRDGRQFAETCAKTLGWLSGELGNLT
DRLLVSAHRPTLQHQIDTHEPVYREVMGREHEVIMLLNKGRDLQDRPGQTTDRGMQRDLE
KIAQQWDRLRSAAVDRHSRLQTCMEHCKKHAAASEAFLSWLRGAEDKLSLLKPGLLKKQQ
LDQQLRDLQTFRSDVWKRSGEYETCRSLGETFIGACDVDKEAIKAELQDMKDRWERLNNE
LLARAQTLETCAKRLGDFNEELRDLDHAVGRCEDRLAAHDALGGAAKDPKLLERVRAIKD
DAAALRKPLQSVRKLAGEIAAEARAAGGDGDHLKSEVDGISDRIEDLHARLDDRCGELQS
AATAVSQFNDQVKLLGVDLNDLEQQVDSLHPPAREIKVVLNQLDEVAGILGKIDRAASNV
SEVERAGEQLVDCGFAPDTAQTRDQIGTLRKQLGRLENRARDHDDALQRALKALEKFYDL
HQHTQEDLGDVSDQLKKMKPVSSELEQIRHQQEDFRRFRQRVVEPLTGKIDELNRLGQDL
IRSAQGGVPTALLEKDLEKINDRWNDLKEKMNERERRLDVGLLQSGKFQEALDGLSEWLK
VTEEMVANQKPPSADYKVVKAQLADQPFLMKMLSDRQETMASMFELGQEVAAGCDASEKA
AIERQLKELMRRLDDLTDAAQRRTHDLEQAMHVAKQFQDQLIPLTKWLDGAERAVKAMEL
VPTDEEKIQARIREHEQLHDEILSKKPDFTELADIAAQLMELVGDDEAVTLSEKVKNTTD
RYTDLVVASENIGHVLNESRQGLRHLVLTYQDLVSWMEKTEGRLQRFKIIPVHTEKLLEQ
MNALVMLNEEIASRSPNVESTVEAGSELMKHISSDEALQLKDKLDSLQRRYGELTTKGGD
LLKHAQDALPLVQQFHDSHLRLVNWMQAAEASLATGDANENDIARLEAELSEIRPLLEQV
NSIGPQLCQISPGEGASTIEGIVTRDNRRFEAIVEQIQRKAERLHLSKQRSNEVTADIDE
LLEWFRDMDATLRDADPPAMTPKLVRTQLQEHRSINDDISSQKGRVRDVTAAAKKVLRES
QPNDNTIALREKLEDLKEVVETVAALCSNRLSVLEQALPLSEHFADSHTGLATWLNDMEH
QISMLSMPALRPDQIAIQQDKNERLTQSIAEHKPLLDKLNKTGEALMALVADDDAAKIGE
ILDSDNARYAALRTELRDRQNALDQALQESAQFSDKLEGMLRALQNTAEQANQADPISAH
PPKIRDQIDENVALVQDIDKRGEAFAAVQRAASDVISKATNQSDPAVRDIKKKLDKLNAL
WGDLQKTTAKRGTALNDTLGVAEKFWKEMQAVMETLKELQEALQTQEPPAAQPQAIQKQQ
VALQEIRQEIDQTKPEVEQVRRTGSNLMSLCGEPDKPEVKKHIEDLDNAWDNITALYAKR
EENLIDAMEKAMEFHETLQNLLSFLKRAEERFQNLGPLGSDIEAVKKQIEQLKHFKDDVD
PHMVEVEALNRQAVELTERTSAEQAGAIREPLNAVNRRWENLLRGMVERQKQLEHALLHL
GQFQHALNELLVWINKTDANLDELKPIPGDPQLLEVELAKLKVLANDIHAHQSSVDTLND
AGRKLIENDRGSLEASTTQDKLQQLNKQWRDLLQKAADRQHELEESLREAQAFTAEIQDL
LGWLGDVDAVISASKPVGGLPETASEQLERFMEVYNELEENRAKVETLIAQGQEYVRKQT
QLQVSASNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDALQAFVEWLTQAEK
QLSSASAVSRVLETIQQQMEEHKVLQKDVSIHRESMLLLDKKGTHLKYFSQKQDVILIKN
LLVSVQHRWERVVAKAAERTRALDHGYKEAREFHDAWVQLTGWLKETEKTLDTLAEETSN
DAVKIKKHLEKLREIQRNLQSKESFYDSTMRNGKGLMDRAPKSDEPVLSKMMGELKDAWK
RVCHKSVERQRKFEEALLLSGQFADALQALLDWLRKTKARLAEDGPVHGDLDTVTTLVEH
HRQLESDLDKRSAQMQSVMKTGLELERSDETRETSKHLKEMQRLWDDVQDLSGRRKSRLD
VALKEAERLHKSVHMLLEWLSEAEQKLRFAAAAPDDESQAKDLLDTHAKFMKELREKEYD
KEDTIGLANSILGKAHPDAIPIIKNWISIIQSRWDEISQWAISRQTKLEQHLKDLQDLDE
SIEELLAWLAGLEATLLNLETEPLPDEIPPLEVLIADHKEFMENTARRQGEVDRACKPRQ
PPPGLKETRKPSRGVLKTPIFKGSRDQGLNSRRTRCSPGRETQTPERDRLPHYGPRFSTS
NQADTELRSPRAKLLWEKWRYVWMLAWERQRRLHDHMLYLQDVERVRQFSWEEWRKRFLK
FMNHKKSRLTDLFRKMDKDNNGLIPREVFIDGIIGTKFDTSKLEMGAVADLFDRNGEGLI
DWQEFIAALRPDWQDRKPKTEADKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKL
RLVRILRSTVMVRVGGGWVALDEFLVKNDPCRAKGRTNIELREQFILADGVSQSMAAFKP
RMSGSAGSGSNQTSSPIPTQGPIVKVRERSAKSISMSRPSRSSLSASTPDSLSDNESGIG
TPGRFQTPSRKSSVPASRSQMTPGGSRANSRPSSRPASRAGSKPPSRHGSTLSLDSTDDA
TPSRIPTRRLTQTSTPRPSRLSVGSVSGRTGTTTTTTTNGVSSRTASGAASPAPTRNGGM
SRSSSIPTLIGLPNSRKTSGASTPSGMQTPRRTSVEPGTAPPRPESRNSRGTTPSEKRAP
FRL
Download sequence
Identical sequences Q7Q2Y5
AGAP011396-PA|hypothetical XP_317924.4.40869 AGAP011396-PA 7165.AGAP011396-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]