SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP012304-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP012304-PA
Domain Number 1 Region: 9-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.47e-45
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP012304-PA
Sequence length 184
Comment (Anopheles gambiae)
Sequence
MALERQVRAKIAGKRDLEKDKEAQYWIEEVLGEKFPAGVLYEDALRDGLILCKLINKLEP
GAVAKINTSGGQFKMMENINLFQQAIKKYGVPDLDVFQTVDLYEKKDIAQVTSTIFALGR
ACYKHPEFQGPFLGPKPADECKRNFTEEQLNAGQAIIGLQAGTNKGATQAGQNIGAGRKI
ILGK
Download sequence
Identical sequences A0A182KSL8 A0A182U829 Q7PV70
AGAP012304-PA AGAP012304-PA|hypothetical XP_320237.3.40869 7165.AGAP012304-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]