SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP012319-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP012319-PA
Domain Number 1 Region: 55-155
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 7.2e-27
Family Insect pheromone/odorant-binding proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP012319-PA
Sequence length 176
Comment (Anopheles gambiae)
Sequence
MKIELFTLSAPTVPRPGGPHTEGGRNADNFKLYSSLFVFPSPLQGARLEAEHVRRIHQNA
RECVKETGILPKNAFRVLSGDFSVDTMKAKCFVKCFLDKAGFIDDDGVIQQDVIREKLTV
GIEAGKVNELIKKCSVEGTDACDTAYQMYKCFFSNHKVPKELFQMRKGIGRRNMQQ
Download sequence
Identical sequences Q8I8R8
AGAP012319-PA 7165.AGAP012319-PA XP_320225.1.40869 AGAP012319-PA|odorant

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]