SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ001732-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ001732-PA
Domain Number 1 Region: 11-72
Classification Level Classification E-value
Superfamily HMG-box 0.00000000602
Family HMG-box 0.0059
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ001732-PA
Domain Number - Region: 81-115
Classification Level Classification E-value
Superfamily Double-stranded DNA-binding domain 0.0602
Family Double-stranded DNA-binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ001732-PA
Sequence length 124
Comment (Culex quinquefasciatus)
Sequence
MPPKKKAAVKGPFFFFMLEFRARQQAKGQQFPGGMEQVMREAGPHWDKLDDEMREVYKDK
AKAYKKLPKQNYGEKYTAQGIPYSVVEKEQRERAAKVELIRNSIAERIQTAVIQNKLETM
KVGY
Download sequence
Identical sequences B0W4G3
XP_001843597.1.94360 CPIJ001732|conserved 7176.CPIJ001732-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]