SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ003011-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7176.CPIJ003011-PA
Domain Number - Region: 159-224
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.000162
Family Coagulogen 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ003011-PA
Sequence length 224
Comment (Culex quinquefasciatus)
Sequence
MANGRGRHLDSGARPAEDSSSSSKSAAHLQAYSRVRQCVIMAQWMFALLLTFTQIARAAQ
SLWPNLPSSVEQQQTLLEKCSSSGNLKYISGNALTDSPNCLGPNNAPYPSAAVSRTFSSW
NPSGSSRRGRMSAPPTLDPKLMQRTLLQAYGDVNENEMIEDVRTRYSRSVDSQQQCRDTP
SRLCKTRYNTTAPMYGVSLTSGQPVTIVQKFPDLLQQVVFEVCE
Download sequence
Identical sequences B0W869
7176.CPIJ003011-PA CPIJ003011|conserved XP_001844903.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]