SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ005702-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ005702-PA
Domain Number 1 Region: 28-62
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000153
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ005702-PA
Sequence length 68
Comment (Culex quinquefasciatus)
Sequence
MADEDNVMDEMPECDNKFAMRNRGRKGALKKKNVYNVKDHHFIPRFFKQPTFCSHCKDFI
WDSREREV
Download sequence
Identical sequences B0WEJ1
XP_001847125.1.94360 CPIJ005702|conserved 7176.CPIJ005702-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]