SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ006592-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ006592-PA
Domain Number 1 Region: 47-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-63
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 
Domain Number 2 Region: 466-560
Classification Level Classification E-value
Superfamily E set domains 5.27e-16
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 565-655
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000018
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 4 Region: 276-376
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000223
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 
Domain Number 5 Region: 999-1089
Classification Level Classification E-value
Superfamily E set domains 0.0000000000036
Family Filamin repeat (rod domain) 0.0096
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ006592-PA
Domain Number - Region: 384-464
Classification Level Classification E-value
Superfamily E set domains 0.000187
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ006592-PA
Sequence length 1159
Comment (Culex quinquefasciatus)
Sequence
MDLPKGAKITHAGLLQHTPDGKKEIQKITQAGLVARSPEGTAAKGMNIRGNEDLWVEIQA
NTFKNWVNEHLRESGMQVTDFHDDFCDGTYLCALVEGLQKRPLKPSWNKRPANQHHYLEN
ATTALNAIEADGVKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAWLQ
AALPDCKVSNLTSDWNSGVLLSALLDYCEPGLFPHWRTLDVHDSVRNCERAMNLAYERFG
IPKVLEPEYLASGWLDELSGMTYLSYFMKPDGPGYNATMRWVNSTIKRPVSNFTTDFNDG
KVFCEIIKDLGGPVPDPAKLSSDPIMWESNQNKVIEGGLKLGVKPVLSAKDMATADEEHL
GVMAYTTWLRWVIPRPPLADMFAVHLESTSGRVGEQTRFRVEVLSREVELSKVKAYVATP
NSNTMQPVKLNSKGEGSYVPDKYGMHEIVLEVDDNQLGGHFFRVLPRLVHVAPPGMAPCA
LGSLVEVLVNATGAPKSEDILVTAYSPSGRPLKCPLKKLDPGHSAIFKPDEAGVWEIAIT
YQGRHIQGGPFTCSVFDPCGVSVHGLDGAMPLRAHSFEVDARGVGVSGELHVDIVHEKRS
LVCSVEKLQENKYQVTFLPRQNGKHRVYIYFNGYDVKGSPYIMRVGSKGRSGKTRSSPSH
DNRMRSESPSYHFNSSSLNRKNESSLKREIYSPQTVQTTRETYSSRVTSPLRESPSPREI
QRSEFKNLSTDNIDYGFKKSTEMLASDFKTPPKDDAYNYVKTIRTENHVTKTIRSHRDSE
SPSLIRASPGLKSPQTVSSTIYETNSRNATASPKFFTSTTRYVPSPVDHRISSPINMHEK
NETYKVTERESSYKSTITRDVVRDSPTIDMYKTAPSAVDYSSNIRVTANNNGPSRRDSRD
VINKTKHMFSHNSLESLANLTEKQLNTDLTYDRAVDSQTEKNTHFNKFSLGENNHRPADR
KIIEDEGLYRPGGYLKNYKTESSSNERYEKYTTLNSGFEPIGRDVTGARAIRVQDIPDGV
LGRPVEFEIDGSQAGSGNLEILVNGGRVTSAVRALGNQRFIASFTPHESGVHTVQITFNE
ETVPAGPETTALLLKKRMRLGSELVDDGRNTEYVMMDRWRCLSAAGEKKFTAESDMTLVE
AFRPDVSWPLFDSDTDGES
Download sequence
Identical sequences B0WI36
CPIJ006592|conserved XP_001848370.1.94360 7176.CPIJ006592-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]