SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ009660-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ009660-PA
Domain Number 1 Region: 11-169
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.91e-53
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 189-310
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-32
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 2117-2277
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-32
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 4 Region: 2944-3098
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-32
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 5 Region: 1482-1636
Classification Level Classification E-value
Superfamily Spectrin repeat 9.75e-32
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 6 Region: 2733-2888
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-30
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 7 Region: 587-705
Classification Level Classification E-value
Superfamily Spectrin repeat 3.87e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 3638-3756
Classification Level Classification E-value
Superfamily PH domain-like 6.31e-28
Family Pleckstrin-homology domain (PH domain) 0.00039
Further Details:      
 
Domain Number 9 Region: 3262-3414
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 3157-3285
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-27
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 11 Region: 1002-1115
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-25
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 12 Region: 1701-1847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-24
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 13 Region: 1278-1392
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-23
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 14 Region: 2630-2760
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-23
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 15 Region: 1905-2061
Classification Level Classification E-value
Superfamily Spectrin repeat 3.86e-22
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 16 Region: 869-1003
Classification Level Classification E-value
Superfamily Spectrin repeat 5.84e-22
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 17 Region: 1179-1319
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-19
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 18 Region: 2275-2390
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 19 Region: 1395-1518
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 20 Region: 483-600
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 21 Region: 256-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-16
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 22 Region: 2522-2626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000259
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 23 Region: 3375-3519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000116
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 24 Region: 735-813
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000394
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 25 Region: 2440-2536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000767
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 26 Region: 2389-2438
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000304
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 27 Region: 2892-2964
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 28 Region: 390-475
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000381
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 29 Region: 1117-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000388
Family Spectrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ009660-PA
Sequence length 4186
Comment (Culex quinquefasciatus)
Sequence
MASRRSLVQTLTLQSSLNVRLESIGAEDIVDHNPRLILGLIWTIILRFQIQEIEIDVDEE
NESSEKKSAKDALLLWCQRKTQGYQNVHITDFSGSWRSGLGFNALIHSHRPDLFDYGGLM
PGRNIENLNHAFEMADRELGIPKLLDAEDIDTARPDEKSILTYVASYYHTFARMKNEQKG
GKRIANIVNKLMDADKKKMQFENLITDLLSWIRTKTVELEKRNFPNSVEGIQGELLAFKE
YRTIEKPPKYKERSEIEALYFHVNTLLKTLHQPHYTPQDGKMINDIEKAWRALENAEHNR
EVALREELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYGANLRQVDATVKKHEA
ISADILARADRFNDLTDMCNELHNENYHGKQQVKERETEVITKWKELLELLENHKNKLTQ
MSGLMNLLREIDATLVTIQALKVQFASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRR
YIRQGEAYKKTGTKDTSQLDQKFSELAEAYKELQGCSAERRARLDEARDFYQFVEDHENE
EGWLVDKQRICKAGITAKDLRAVVSLQQKHKALEDEMKVRKPKSLQIKESGKKLITDKHP
RRADVQAKIDSLQEHWKALEELVEVRKRQLDDAAEAYQFYADANETDSWLNEKMALVASD
DYGVDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLDLSAEPEPAQEI
EQEEWVNETRLVPKEVWEEEPVERLEHKTVTENKLLPHVRSLYPFDGQGMKMAKGEVMIL
QNKTNPDWWNIRKLDGTEGFVPANYVKEIEARPVPCLIRKAEKVKVMQKVKKTILVKQVV
PVKRVRPAKASQVKPLVKRRTDGDNTSIDNNDSVDKRQKHINSTYDQLQELAERRRALLE
DSICLFRFYRECDDFEKWIKDKEKMLRTDDPKDNVETAKRKFETFLTDLSASSKRVEAID
SDVEDFVRQGHSQLDKVKARQRQIHQMWEHLNYLKGQKEKNLEGASSVELFNRTCEEAID
WMNEKMTQLDTAEVGPDLKTVQALQRRHENLERELAPVQEKVNRVNLLGNTVKNSYPSER
DNVTDKQRDIQGLWKKVQEKAKERRSRLENAVGQQIFTNSTKALLAWIEGVHNQLNAEET
ARDVETAENLLKKHNDLGEEIKTHDDEFKQLAQLGNQLQSRNPNLVDVPEMIQKLSAEQE
AVQAGWLVKEKKLQQCIELQVFNREADKIDATTKSHEAYLEYADLGNSLDDVEAILKRHT
DFENTLGAQDKILRNFSDGADKLIRNNHYDAKYIAERRDQVLARRAKVKDLAQKRRNALQ
ASKDFQKFCADVDDLNAWLADKAKIAGDESYKDLTNLPRKLQKHKAFERELRANEGQLRT
VNKEGEALIKTNNRAEEVTLMLAAVNQKWKELNTSSLEKGRRLEQASLQREHNRYIEDAK
SKLEELDAALQSKQVGNDLRSCKDLMNKHQVLENDISMWEQKVAELVTSGEEMAHEGHFD
ANNIKNETKKIQNQFANLKGPAAKRREALEESLRFHKFVFELDAELQWINEHLPAASSEV
IGQNLHQAQSLYKKHKKLEAEIEGHQPMINRTLTSAENLINQNHPETAQVKELCNTLDLA
WNDLQSKATERSKKLELSLKAQQYLSEAGEIETWLGERNNVLRSTDYGRDRDSATKLLTK
HKAIELELDTYSGIMSEMGHAASAMVAAKHPDSKMIAAKQLLIEKMLKSLQKLAAQRQLR
LMESLYRHEYFMESADLEQWIKEQEQAVNSEDYGHDYEHLLILKNKFDDLKHRIEVGAER
FNQCEEFAKKLIGGDSPYVAEIEKRQEQLSNCWQNLLKQLAAREKKLHAAGEIHRFHRDA
AEALFRIQDKNAALSTELGKDLNSALALARKHEAFENELVALEAQLQFLVDDSLRLQAKY
PGDNAKAIAAEQENVIQAWNVLKEKSALRNDQLQASCDLQHFLTQVRDLMSWATNLRAAL
QAEEHVSDATGATALKIQHDAIYGEIEAREETFRYLNELSDSMVQTGHYAATEVEEKCSA
LLDERAKLHSAYNKKKILLEQKIDLFCFMRDAKVIDNLSSGQEAALSSSDFGQTVEVVQD
QVKKHDAFEKLIQTQDEKVMILQDHGRKLVEQNHYDSENIRRRLREIVERRQKIKELCAL
RRQKLQNALLYAQFIRDCAEAGAWINEKQKKLEADASGFADVTNMEDKVKKLQKHQAFQA
EVAANEGRIKEVNQKGQTLIAKRHECAAEIEEEVRKLSESWNVLLNEVASRGRGLEEAQD
ILEFNSQLDKLEAWIRDKEMMVHASDTGRDLEHCNALKRKLDDVDSDMRVDDQRIKTINV
LADKLLTQEKAPNEAKNVQQRRNNFNNKWKSLQGALNKYRELLDGAYEIHVFNRDVDDTA
ERIGEKQLAMSVDDTGRDLNAVESLKRKQDAMERDMTTEKLVELNASGTTCRRLSVLRAD
ALDNGYTAHKFTADVKELELWTNEIIKKMDSVANPTTIAECQAQIQLHQERKAEIDGRDK
IYKALQEHGERLVAENKAKGIKNDYVEKALRQLEDLNKHLHDSWKGKDRGLKEAHQLQQF
KEQADQIEIWLANKEAFLNNDDLGESFTAVDALIKKHEGFEKLLASSRTEDLEKFAEEIL
AESPFEADVIKQRLCSVLARKEKLLASSATRKQKLHESLQLQQFLRGLYEVAKWISQKMQ
VALDENYREPSNLQSKIQKHTAFDAELGANSSRVTAIIEEGETLINAEHYASALVQEQLD
ILEADWQKLREASREKKERLGEAYEARMFERHLDDFNNWMDEVEQQLSSEDYGRDLASVN
NLLKKHEMLEADVAHHLETCEQTKATDDRFLASDHFMKDELHESAMLTIKRYHSLHEPTT
IRRDNLEDSLQLHQFLRDAEDELSWLNEKEPLAASKDLGNSLTAVQSLQKKHQALEAEIL
SQEPTISALIQRGQQMIRDNHYAVEQIETQSNLLQQKLINLRNLTNVRRLRLLDAVESQQ
FYAEANEAESWLREKKPIISSHDYGKDEDSVSSLQKKLDALQRELTAFRPTVEKIDKLAG
GLQERGHFDSEKIKTKNDKIQYQFQELNRLAGEREKKLAETKKLFEFIREIDDLQEWIDM
QMTTAGSEEYGTDVEHVEQLTTQFESFVSNINANEARVNACVAKGKSLLNEGNPNKDLIK
AKRDETKQLWEELKDLVIARQEALAGAKQVHLFDRTADETISWINEKISAVLSEDYGHDL
ETIQALVRTHESFEAELGAIKEQLESVVSEAQKLGDTFPDAKEHIEVKRDETIEAWSELK
EKTIQRKEKLMQAEQLQAYFDEYRDLMAWINEMLARITAPDLAKDVAGAEALIAKIKEHR
TEVDSRSEAFETFYKTGSKLIKDGHFLANEVQEKIAVLNQRKRLLDNTILQRAEIYELNL
DTQIFLKEAEVIESWIISRQVQLKDGKLGESIAQVEDLLRKHEDFEKTVAAQEEKVLALK
RITLLEQKFKRQLEAEQAARVAEKERVERERHEALKQKEVQRITEERRRHDVNSSPSVVN
GYSGGTPNNKSATSSHLSPASAASAVAVGGFSKEAPEVSPVQKSNSFATMLQERLRRGSE
GNIKRAESMKIGPKPAKRTPSFTTRRRAQSFRKNQRGSDSTESDLPPVEMQGMLERKHEL
QSGGKKAPVRSWKPFYTVLCGQLLCFFKDVEDFSQKKAATAPVNILNAKCDRAEDYTKKK
NVFRLVLLDGSEFLFLTGSKESMNEWINKIAFHAALPPNLQLMSYDESVKQSPGLQINPA
SPILDRSDANSSISSRTSSPDSQRRDSRASLNSAKSGGSGSNASSGLQTPQINFLQKQKE
LRELENQQRLSQQQQQRMSPTGGPTQEFYGLADKPPIPPRGVPPPVPQRQSSNENVLNNN
NPNGGTVQIRPKTSSGSSGSFNGNGDLKHKVTSEKLVTLAAILVAFIVLAAYEAKISSYL
ANWPHRQDVKTLQDLREANMKVLIHSHSVLLFNEKDHWLRNRLVPMDSQSLIASVTTSAN
VAFVMERYNARIFLKQVTFFDGVENRPRYVMLEDPVDTSLTFFNFGSRNSFLARFVQLQN
RIYEAGLDQHWVELLLAATLTIQNQFDSAPKMIQLEQLQHLRSILFFLWVCSVLVLLLEL
GYVRIRRIVLEFGHRRKVGVMRPRKRAHTYPFMKKARWMNTNRKSI
Download sequence
Identical sequences B0WRM4
XP_001851358.1.94360 7176.CPIJ009660-PA CPIJ009660|spectrin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]