SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ013032-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ013032-PA
Domain Number 1 Region: 7-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-63
Family Calponin-homology domain, CH-domain 0.0000236
Further Details:      
 
Domain Number 2 Region: 2855-2975
Classification Level Classification E-value
Superfamily EF-hand 2.68e-38
Family EF-hand modules in multidomain proteins 0.0000612
Further Details:      
 
Domain Number 3 Region: 2976-3078
Classification Level Classification E-value
Superfamily EF-hand 2.36e-33
Family EF-hand modules in multidomain proteins 0.0000656
Further Details:      
 
Domain Number 4 Region: 3061-3147
Classification Level Classification E-value
Superfamily RING/U-box 5.06e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 2398-2537
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-20
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 2500-2632
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 7 Region: 2653-2790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 8 Region: 493-633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000257
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 9 Region: 317-423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000209
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 10 Region: 2823-2854
Classification Level Classification E-value
Superfamily WW domain 0.0000000178
Family WW domain 0.00086
Further Details:      
 
Domain Number 11 Region: 1406-1520
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000489
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 12 Region: 391-486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000905
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 13 Region: 1165-1276
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000354
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 1283-1401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000366
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ013032-PA
Domain Number - Region: 1098-1206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000252
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number - Region: 2212-2283,2310-2337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00892
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ013032-PA
Sequence length 3479
Comment (Culex quinquefasciatus)
Sequence
MAHIDSILQVLSYERQDIQKKTFTKWINGYLAKSGTPPINDLFEDLKDGHKLLSLLEVLT
NQRYKREKGSMRVHQINNLNKALNVLQECGVKLVNISSDDINSGNAKLTLGLIWLIALTF
DGQKLVNSQAKSGIEKSLLVWARQLADKYGIKVNDFSTSWSDGSAFLVILSEVIEAINLQ
EALKKHPIARLRMAFDLAYHHLNIEQLLDPEDVNTSKPDKKSILMYVMCLYNAIDSRKIA
RQQSVQHLAQHAESLEEIQLLSEKEMDDATDTDDNLRNNNVHEQNNVSTTHEVEGWESKT
SRPVSTATNFSTEFSGYQIAVEEVLTMLLEAEDFFSKEVVDSNDLAEAKQQFHSHEEFMK
KLLEYQTFVCGALDEGTRLISESQSNGLDLEGQNEIKHQLFLLNERWEMLRVNSLERQAQ
IHKRLATLQMQKIDELSNFLRMTEERISHMQNIGPTPVELKVQLEEHKRLQHDMEKQEIL
VESLSNLVIIIDSESFSDLEDKLSALEERWSHLLKWIGNRWDKLQSLSQRWTKLSERYRV
ICRWIDCREQNLKKMESYESAEMGAMMERISCLQYCKNDINMLGKSLRELESVAQELDDE
GYSSLNILTKVEHLTDMCDALIQIIQAQSARVENMGFQIPPVSNIGSLVKPNSWEDFQIK
ISEETEVDKPVPEVDNLDSSEYYLPQSEKKRKIEQPEGVVQLNECMFGLRSSLDNCVSRL
DRFERFQMKDRLLLKEVENCVKTCNEEHNFARQKLSECERMCNVNLEIESQQLNELGSLL
YSIEQKVTTFNVQWEQILAEEKLSNDLTRFKLSLADTRDWYQQHATMSTVDELEKRLLSM
NSIANDIEESRQKLKHPDAKSQATKADFDQFYASWVDMKNAIYQIIIDKSSFRSSDENIQ
KMQALIDQAERQIVVYSDIEHTHQNLEALHSVKAVYTKLREEGYDDLASRLSIDGRFTEL
VTSWRNIPQALNDTIIKQNIVIENMNHFYAEHKSILQNLAQIELGLQEEIFIPGEIKTLQ
LKNVESVKHATELKKIDIDIISIKNFAETVFEKCKSEFKTELHRKIQILVEQHEKVNAVY
KNNYSKLTQISSISESILTKVHETELWLNDLEKNTPKNLNSEINNLNELYQIKSKFCALK
ETCEQQTAMFRELNEAGNEILLQIDEMIQSKADNKASHLAKKFTKLNARWNEVTSCVYQR
TGLLEHISSQLGEFKTLVVGETNYLDKLEKLLRRSPENAADAEEISEELDDIENYIRNHP
EARFDKIIAIGTELCNLEFMVSLIEKDLQTISDRWEALQIQAKQRTTMLELAVKEAQSSE
RQVICLQQWIFRIESILNEFLENDTTVEDVPHDFQKLQDEFETQEKMLLETKKKVDHYKQ
EGKLEAANRYQDQIKLLESQFRACKKKLDQLTSPQATFETKLNHALVKLRNVEKSTIILD
PFSAGPLNLQDQLQHCLKMYRMLSEVKSEIEQVIRTGRKLCEDKSTKNAAKLSQRIDTLK
NLYNSLGEIVTQSKITLENLLRIMRCLEEELITVERLCRESETGQLTDDERNTFSEKIAE
CNNLYEEYTKTCDSKHLEDFENRIKNAQNIFQKLCQSERNKIENQEADNDPSTISVTFFL
GGTSGGHRKSIFGSNVCLGKIHIVIKFQLCKYQRSKVTITFIMLLGHIDPKTMPGLNTWA
KNTNHEIVVLSDTVRQRRARTMNLQQTEGKKEPQQKDLQLPATFRLAEKSVLFSRVSNNE
PLNETKLTSNMQSEIERNKCSVVEIKEKNIPTKMSVQNVEICPWDEPMHGQLVDNINVLE
MCQTFEPEFVETVNIIDASESDTSCPSPKLESRDKMKDVLLMEATIKTANTKRKPTSQND
CGVLMGSKRFFDSTKICRSFNISSEERDSFYNSDNENYDEPLMFSEDEDIPRYSFELAAD
SDSDTVKIFFFYMQFMQFYELPSPPLNSDVYRYDSYKKLTSLEQRVNEFDKTAKYMIKKL
DQIREQLSSCGGGTNTIENLKLTIAPDAATLISQGDTLILETHGKSKTLTQRLMETQANL
RDKFKSVQSFRNYQDLDATPQQLNSTNDNDGSFNDSTHSKSIDLDEITTKVLKRINDLLV
KPIAKDNEAELTKRILDIKERQEEAKLAIDVASQTAPSESVSNIMTVIRNVLKAYENKKA
QIDEIVTVVDNLKSDTNYQYLENKEFESSVQGSNAVNSRARSVPETSASSVEQSMSQIAN
WLQLEHELLNKHCVVFGDTDMMLSAIEKGKNTIKQLENKKAQIDEIVTVVDNLKSDTNYQ
YLENKDFYLMFYSFCCSPSQHVSKTNQIYHFLVATRMRDQWEDTSQSVLERKSQLTAMLG
DSQRYEAKRIDIESWLNRMESRSERMGVVATTADVLEIQQKEQKSFHAELHQYKHHIELF
NQLTQKLIAVYPSDDTSRIKRMTESVNLRYNNLNNAVISRGKSLHAAVHSLQSFDKSLDQ
FLGWLSEAESLCENTESEIDRNPHSFKDLQSEIESHRIIYERLDSTGKKLLGSLTSQEDA
VMLQRRLDEMNQRWNHLKFKSVAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELTSLG
LGPMKGDAASLQKQTDDHRAFRRQLEDKRPVVENNLLTGRQYIAKEPPLSDTSDSEAIDS
ESRYLSAEEQNKELTRSIRREVSKLSEQWNHLIDRSDNWKHRLEEYMTKMRQFQKVLDDL
SSRVASAETLTQSWTTPVTTADSAEQMQHLQRLKDKMTTAGALLDDCNEQQGFFTANHVL
VPNQCLAKLEDLNTRMKLLHIAMDERHKILIANGANQSSTADPDGNKSTHGISTGTIGPI
PNLATSVKPPWERAITPANVPYYINHERENTHWDHPEMIELMKSLADLNDVRFSAYRTAL
KLRTVQKRLAFDRLTMNVAIESFDRHGLRAQNDKLIDIPDMTTVLHSLYVTIEPIDMPLM
LDLAINWILNVYDSQRTGQIRVLSFKVGLILLCKGHLEEKYRYLFRLIADLEKKVDQRKL
GLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCFERAGVNQNGEPLETAIEAQHFLNWLQH
EPQSLVWLPVLHRLVAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFLGRNA
KNHKLSHPMHEYCTTTTSTEDVRDFTRALRNKFKSRKYFKKHPRVGYLPVQSVLEGDALE
SPAPSPQHGAHTLQNDMHSRLEMYASRLAQVEYGTRSSSTPDSDDEHQLIAQYCQSLPNN
GGPKSPIQVMAAMDAEQREELEAMIKDLEDENSSLQAEYERLKSKQTSITTPDENQAGAN
GGNDMVAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDEPNNSKASTLQTRSV
TASQLNTESPVKFQQNGHHDQKSSLENGTSSGSFHNNAGISGLSSGGGDNDRSKPGVGKN
ENNIGVSFASSDARPPPPPHTSLLHMAGDLNKAVEELVNVITEQEIEQQNDNGVHDLTD
Download sequence
Identical sequences B0X0E8
CPIJ013032|dystrophin XP_001863120.1.94360 7176.CPIJ013032-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]