SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ013592-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ013592-PA
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000301
Family CRAL/TRIO domain 0.0087
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ013592-PA
Domain Number - Region: 177-214
Classification Level Classification E-value
Superfamily MPN010-like 0.0615
Family MPN010-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ013592-PA
Sequence length 261
Comment (Culex quinquefasciatus)
Sequence
MCGRSKDGCPLITFPDYNNFHNLSDLDYQKLILYLTSVPSLSEADLGFNLIIDRRKDRWA
AVKAVLLKISIYFPGMVHFVYVLRPSGFLQKAISEVSNKFFKDEFRFRVVVCATLDDLYE
YISKTQLTLELGGELAYSHHDWIQQRISLEKFSGLTNMISCNLDVFMKSIHEMEFPNSVD
ATEKLIEEQGEQYEKLKEDIMAAGRHGEVLLEEMRTKKECDKETVERFGNISSIERLKSV
PVRKLSSGKRNPFRDPSFILL
Download sequence
Identical sequences B0X3F5
XP_001864177.1.94360 7176.CPIJ013592-PA CPIJ013592|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]