SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ016952-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ016952-PA
Domain Number 1 Region: 25-142
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.83e-29
Family Insect pheromone/odorant-binding proteins 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ016952-PA
Sequence length 143
Comment (Culex quinquefasciatus)
Sequence
MRYLVILAIGSYVSITGLDHVSGTMTVEDMSRVAKVMRNICQPKFGIPEDVASAASKGVF
PDTPEFKCYASCLMDLTQTSKKGKLNYDAAYAQVQLLPEEYKEPFRIGLDSCRYAADGIE
DKCEVAYVLLTCFFKATPKFFFP
Download sequence
Identical sequences B0XC66
XP_001867238.1.94360 7176.CPIJ016952-PA CPIJ016952|odorant-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]